DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and CG11318

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster


Alignment Length:310 Identity:59/310 - (19%)
Similarity:116/310 - (37%) Gaps:65/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 IAAYLWLPKFRSLHGKCCN--LYFICLAITF------LLNV--ISLFGIFELKTPICYLTGYAGY 298
            :..:|....|:|...:...  |..:|||:..      .||.  :|...:....|..|...|.|..
  Fly   517 LGIFLTAALFKSWRSQASTKVLLHLCLAMCLQMMLFVFLNTDDVSEALVVNGNTVRCVALGAAMQ 581

  Fly   299 FTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETN 363
            ::::..|.|:.:|:|..::|:..   .:..:..........|:.|....:.|.::.|:|      
  Fly   582 YSILVLFSWMLIIAFLQFQRYVT---VIGIERPPRYILKAAIVAWLLPLVPTLLVALID------ 637

  Fly   364 LDNPYNPAVGVFS-----CWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIY--VENKQNQK 421
             .:.|.|:....|     |  :.:|:...|....|:.::.:.|...|.    |::  :.:..:|.
  Fly   638 -PDSYVPSAAQLSTDTGIC--YPSGYGLIFGVVLPVTLITVCNLVIFV----YVFYSISHSLSQS 695

  Fly   422 VLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINC----SQG 482
            :..|.:...:.:    .|:...||.::|.:|...|.||:        ...:...|:.|    .||
  Fly   696 IHKNEKKMVVKQ----IRLSIMLFFLLGLTWIFGIFAFM--------QAGVAFSYLFCITATMQG 748

  Fly   483 IIIFVATFCNHEMFRLIRKRIQNRNI-------TSLELTNTSRPVESEKM 525
            .::|:       .|.|:..  .||.:       |.:||....|..|.:.|
  Fly   749 FVMFI-------YFVLLDS--TNRRLWVGLICPTKMELDVQKRTTELQSM 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923
7tmB3_Methuselah-like 236..504 CDD:320167 51/280 (18%)
TM helix 2 258..280 CDD:320167 7/31 (23%)
TM helix 3 291..318 CDD:320167 6/26 (23%)
TM helix 4 335..355 CDD:320167 3/19 (16%)
TM helix 5 383..412 CDD:320167 5/28 (18%)
TM helix 6 433..460 CDD:320167 7/26 (27%)
TM helix 7 468..493 CDD:320167 5/28 (18%)
CG11318NP_651842.3 GPS 437..475 CDD:280071
7tm_4 500..750 CDD:304433 48/260 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.