DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and Adgrf2

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_017173054.1 Gene:Adgrf2 / 435529 MGIID:2182728 Length:673 Species:Mus musculus


Alignment Length:485 Identity:87/485 - (17%)
Similarity:162/485 - (33%) Gaps:190/485 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LNGSVIKKHVLNDMVVQQDLP--------------------LPCERHYSLDAETSTYDMW----S 162
            |..|:::...:|.:|:...||                    ..|...:||:   |.:| |    :
Mouse   286 LEASLLENVTVNGLVLSVILPEELKNISLIFEKIRKSGERKSQCVGWHSLE---SRWD-WRACKT 346

  Fly   163 LYENGSLFRHFDQRYLSKQEFC-LQPNPTSTGKNYSLIVAFNCIQKPSMKMAYGRFECVRKSRLS 226
            :.||            |:|..| .:||...|  ::|::::.|.::.|                  
Mouse   347 IQEN------------SRQAVCRCRPNKLYT--SFSILMSPNTLESP------------------ 379

  Fly   227 NASIPVKFSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLL-NVISLFGIFELKTPIC 290
                          |:|...|:      .|....|:| .|||||..|: :.::       ||.|.
Mouse   380 --------------VLTYITYI------GLGISICSL-IICLAIEVLVWSQVT-------KTEIS 416

  Fly   291 YLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKF---QVFYKNKRSS------FFNYNIIVWSSA 346
            ||. :.....:.||.|..     |.|  |.:..|   .|.:.|...:      ||..::..|..|
Mouse   417 YLR-HLCIANIAATLLMA-----DAW--FIVASFLSGPVLHHNGCVAATFFVHFFYLSVFFWMLA 473

  Fly   347 -------GLL--------TCIIF----------LVDQFVETNLDNPYNPAVGVFSCWIFTNGWSA 386
                   |:|        :|::.          ||...:...:..|....:...:||:..:...|
Mouse   474 KALLILYGILIVFHTLPKSCLVASLFSVGYGCPLVIAIITLAVTEPGKGYLRPEACWLNWDMTKA 538

  Fly   387 TFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGS 451
            ...|..|...::::|    .:|...:.::.::                           ..:|.|
Mouse   539 LLAFVVPALAIVVVN----LITVTMVIIKTQR---------------------------AAIGSS 572

  Fly   452 WFLEI--IAFICEMENMWKPLI----------ILNDY----------INCSQG-IIIFVATFCNH 493
            .|.|:  |..||:...:..||:          ::|.:          :|..|| .|:...|..:.
Mouse   573 MFQEVRAIVRICKNIAILTPLLGLTWGFGIATVINGHSLAFHIIFSLLNALQGFFILLFGTILDP 637

  Fly   494 EMFRLIRKRIQNRNITSLELTNTSRPVESE 523
            :    ||:.:::|..::..::..|....||
Mouse   638 K----IREALKSRITSAKWISRVSEDFSSE 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 21/106 (20%)
7tmB3_Methuselah-like 236..504 CDD:320167 60/325 (18%)
TM helix 2 258..280 CDD:320167 8/22 (36%)
TM helix 3 291..318 CDD:320167 7/26 (27%)
TM helix 4 335..355 CDD:320167 7/44 (16%)
TM helix 5 383..412 CDD:320167 5/28 (18%)
TM helix 6 433..460 CDD:320167 5/28 (18%)
TM helix 7 468..493 CDD:320167 8/45 (18%)
Adgrf2XP_017173054.1 GPS 326..373 CDD:383024 15/64 (23%)
7tmB2_GPR111_115 378..644 CDD:320660 61/354 (17%)
TM helix 1 381..405 CDD:320660 10/30 (33%)
TM helix 2 420..441 CDD:320660 6/27 (22%)
TM helix 3 454..476 CDD:320660 4/21 (19%)
TM helix 4 497..513 CDD:320660 2/15 (13%)
TM helix 5 535..558 CDD:320660 5/26 (19%)
TM helix 6 581..606 CDD:320660 4/24 (17%)
TM helix 7 611..636 CDD:320660 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.