DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and adgrl4

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_998532.2 Gene:adgrl4 / 406676 ZFINID:ZDB-GENE-040426-2689 Length:735 Species:Danio rerio


Alignment Length:494 Identity:98/494 - (19%)
Similarity:167/494 - (33%) Gaps:133/494 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KYDYEIDYDGDRVSV-PKHIRGCVCKLKTCIRFCCHHKKLMAGNLC----SQDVYENLTYEYTLD 118
            |:....:..|:.:|: .|..|.......|.:.|..:|.   .|:|.    ...|.:...|....:
Zfish   313 KHPLSANIQGNSISLSTKKARHANNNGSTSVVFLIYHS---IGDLLKPADDPGVADYSRYAAAGE 374

  Fly   119 ITQLNGSVIKKHVLNDMVVQQDLPL-----PCERHYSLDA---ET---------STYDMWSLYEN 166
            || :|..||...:.|    |:.|||     ..:....:|.   ||         |....|||   
Zfish   375 IT-VNSPVIAAAISN----QKTLPLNDVTFTLKHTQEIDPARDETKCAFWEYSPSMMGHWSL--- 431

  Fly   167 GSLFRHFDQRYLSKQEFCLQP--NPTSTGKNYSLIVAFNCIQKPSMKMAYGRFECVRKSRLSNAS 229
                           :.|::.  |.|.|..:.:.:..|..:...:.......:..:  :|::...
Zfish   432 ---------------DGCIRTRVNTTHTSCSCNHLTHFAILMSSARANLLAHYNVL--TRITQLG 479

  Fly   230 IPVKFSSVFFMVITIAAYLWLPKFRSLHGK--------CCNLYFICLAITFLLNVISLFGIFEL- 285
            :.:....:...:.|    .|.  ||.:...        ||:|        |:...|.|.||.:. 
Zfish   480 MVISLICLSMCIFT----FWF--FRDIQNTRTTIHKNLCCSL--------FMAQFIFLIGINKSA 530

  Fly   286 -KTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLL 349
             |.....:.|...|| .:|.|.|:.:....::    :....|.| ||.....|:....:.|..::
Zfish   531 HKWFCSLIAGLLHYF-FLAAFAWMCIEGIHLY----LIVVGVIY-NKGFLHRNFYAFGYGSPAVV 589

  Fly   350 TCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNG---WSATFYFYAPLAILIILNCASFFLTTRY 411
            ..|        ...|...|.....|  ||:.|..   ||    |..|..::|::|..:|.:   .
Zfish   590 VAI--------SATLGYKYYGTSSV--CWLSTENNFIWS----FIGPAILIILVNLLAFAV---I 637

  Fly   412 IYVENKQNQKVLNNSEPQKLSRNH-ANYRIYFR----LFIIMGGSWFLEIIAFICEMENMWKPLI 471
            ||       ||..::..:|...:| .|.|...|    |..::|.:|...::..:.|        .
Zfish   638 IY-------KVYRHTAVKKPEISHYENIRSCARGAIALLFVLGVTWAFGVMYILYE--------T 687

  Fly   472 ILNDYI----NCSQGIIIFVATFC------NHEMFRLIR 500
            .|..|:    |..||:.||: ..|      ..|.:||.:
Zfish   688 TLTAYLFTFANVFQGMFIFI-FLCVLSRRIQEEYYRLFK 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 34/168 (20%)
7tmB3_Methuselah-like 236..504 CDD:320167 63/293 (22%)
TM helix 2 258..280 CDD:320167 5/29 (17%)
TM helix 3 291..318 CDD:320167 6/26 (23%)
TM helix 4 335..355 CDD:320167 3/19 (16%)
TM helix 5 383..412 CDD:320167 7/31 (23%)
TM helix 6 433..460 CDD:320167 7/31 (23%)
TM helix 7 468..493 CDD:320167 8/34 (24%)
adgrl4NP_998532.2 EGF_CA 34..56 CDD:304395
EGF_CA 60..93 CDD:238011
EGF_CA 110..143 CDD:214542
GAIN 188..386 CDD:293098 17/76 (22%)
GPS 416..457 CDD:280071 9/58 (16%)
7tm_4 469..705 CDD:304433 58/289 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.