DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and Adgrl1

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_030099484.1 Gene:Adgrl1 / 330814 MGIID:1929461 Length:1543 Species:Mus musculus


Alignment Length:409 Identity:84/409 - (20%)
Similarity:150/409 - (36%) Gaps:119/409 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LNGSVIKKHV--------LNDMVVQQDLPLPCERHYSLDAETSTYDMWSLYENGSLFRHFDQRYL 178
            :|..||...:        |.|.|:.....|..:.|::.:.     ..|:..|...|      .|.
Mouse   834 VNSQVIAASINKESSRVFLMDPVIFTVAHLEAKNHFNANC-----SFWNYSERSML------GYW 887

  Fly   179 SKQEFC--LQPNPTSTG------KNYSLIVAFNCIQKPSMKMAYGRFECVRKSRLSNASIPVKFS 235
            |.|. |  ::.|.|.|.      .|:::::|...|.:       ||...:..|.::...|.:   
Mouse   888 STQG-CRLVESNKTHTTCACSHLTNFAVLMAHREIYQ-------GRINELLLSVITWVGIVI--- 941

  Fly   236 SVFFMVITIAAYLWLPKFR----SLH-GKCCNLYFICLAITFLLNVISLFGI----FELKTPICY 291
            |:..:.|.|:.:.:|...:    ::| ..|.||        ||..::.|.||    :|:..||  
Mouse   942 SLVCLAICISTFCFLRGLQTDRNTIHKNLCINL--------FLAELLFLVGIDKTQYEVACPI-- 996

  Fly   292 LTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLV 356
            ..|...|| .:|.|.||.:....::    :...:|| :::.|....|.:..:....|:..|...:
Mouse   997 FAGLLHYF-FLAAFSWLCLEGVHLY----LLLVEVF-ESEYSRTKYYYLGGYCFPALVVGIAAAI 1055

  Fly   357 DQFVETNLDNPYNPAVGVFSCWIFTNG---WSATFYFYAPLAILIILNCASFFLTTRYIYVEN-- 416
            |          |.......:||:..:.   ||    |..|::.:|::|.. |.:.|.:..:.:  
Mouse  1056 D----------YRSYGTEKACWLRVDNYFIWS----FIGPVSFVIVVNLV-FLMVTLHKMIRSSS 1105

  Fly   417 --KQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWK-PLIILND--- 475
              |.:...|:|.:                       ||.|..||.:..:...|. .|:.:|.   
Mouse  1106 VLKPDSSRLDNIK-----------------------SWALGAIALLFLLGLTWAFGLLFINKESV 1147

  Fly   476 ---YI----NCSQGIIIFV 487
               |:    |..||:.|||
Mouse  1148 VMAYLFTTFNAFQGVFIFV 1166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 20/97 (21%)
7tmB3_Methuselah-like 236..504 CDD:320167 59/279 (21%)
TM helix 2 258..280 CDD:320167 5/21 (24%)
TM helix 3 291..318 CDD:320167 7/26 (27%)
TM helix 4 335..355 CDD:320167 3/19 (16%)
TM helix 5 383..412 CDD:320167 8/31 (26%)
TM helix 6 433..460 CDD:320167 5/26 (19%)
TM helix 7 468..493 CDD:320167 9/31 (29%)
Adgrl1XP_030099484.1 OLF 214..470 CDD:383019
PLN02550 491..>573 CDD:178165
HormR 548..611 CDD:214468
GAIN 621..845 CDD:374574 3/10 (30%)
GPS 869..921 CDD:197639 12/63 (19%)
7tmB2_Latrophilin-1 928..1185 CDD:320673 61/296 (21%)
TM helix 1 931..955 CDD:320673 5/26 (19%)
TM helix 2 964..985 CDD:320673 7/28 (25%)
TM helix 3 995..1017 CDD:320673 9/24 (38%)
TM helix 4 1036..1052 CDD:320673 2/15 (13%)
TM helix 5 1071..1094 CDD:320673 7/27 (26%)
TM helix 6 1118..1143 CDD:320673 7/47 (15%)
TM helix 7 1147..1172 CDD:320673 7/20 (35%)
Latrophilin 1185..1543 CDD:367050
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.