DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and Adgrg6

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_218313.7 Gene:Adgrg6 / 308376 RGDID:1308551 Length:1248 Species:Rattus norvegicus


Alignment Length:268 Identity:68/268 - (25%)
Similarity:101/268 - (37%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 SVFFMVITIAAYLWLPKFRS------LHGKCCNLYFICLAITFLLN-VISLFGIFELKTPICYLT 293
            |..|...|:..|:...|.|.      |......|.|  |.:.|||: .|:.||:..|.|.:..|.
  Rat   873 SAIFSAATLLTYVAFEKLRRDYPSKILMNLSSALLF--LNLIFLLDGWITSFGVAGLCTAVAALL 935

  Fly   294 GYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQ 358
                :|.::|||.|:.:.:..::  .|:.|  ||..........:.||.|....|:..||.:..:
  Rat   936 ----HFFLLATFTWMGLEAIHMY--IALVK--VFNTYIHRYILKFCIIGWGLPALVVSIILVSRK 992

  Fly   359 FVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLA----ILIILNCASFFLTTRYIYVEN-KQ 418
            ..|......|........|||     .....||...|    |:..||.|.|.:....|...| |:
  Rat   993 QNEVYGKESYGKDQDDEFCWI-----QDPVVFYVSCAGYFGIMFFLNVAMFIVVMVQICGRNGKR 1052

  Fly   419 NQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLII----LNDYINC 479
            :.:.|.    :::.|   |.|....|..::|.:|.....|        |.||.|    |....|.
  Rat  1053 SNRTLR----EEVLR---NLRSVVSLTFLLGMTWGFAFFA--------WGPLNIPFMYLFSIFNS 1102

  Fly   480 SQGIIIFV 487
            .||:.||:
  Rat  1103 LQGLFIFI 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923
7tmB3_Methuselah-like 236..504 CDD:320167 68/268 (25%)
TM helix 2 258..280 CDD:320167 7/22 (32%)
TM helix 3 291..318 CDD:320167 6/26 (23%)
TM helix 4 335..355 CDD:320167 6/19 (32%)
TM helix 5 383..412 CDD:320167 8/32 (25%)
TM helix 6 433..460 CDD:320167 7/26 (27%)
TM helix 7 468..493 CDD:320167 9/24 (38%)
Adgrg6XP_218313.7 CUB 38..146 CDD:238001
LamG 178..337 CDD:304605
GPS 799..844 CDD:280071
7tm_4 861..1108 CDD:304433 66/264 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.