DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and Adgrf2

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_017452241.2 Gene:Adgrf2 / 301269 RGDID:1306718 Length:654 Species:Rattus norvegicus


Alignment Length:488 Identity:89/488 - (18%)
Similarity:166/488 - (34%) Gaps:181/488 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GNLCSQDVYENLTYEYTLDITQLNGSVIK----KHVLNDMVVQQDLPLPCERH------YSLDAE 154
            |.:....:.||:|         :||.|:.    |.:.|..::.:.:....||.      :||::.
  Rat   287 GAILEASLLENMT---------VNGLVLSVILPKELKNISLIFEKIRKSGERKSQCVGWHSLESR 342

  Fly   155 TSTYDMWSLYENGSLFRHFDQRYLSKQEFC-LQPNPTSTGKNYSLIVAFNCIQKPSMKMAYGRFE 218
            ........:.||            |:|..| .|||...|  ::|::::.|.::.|          
  Rat   343 WDRRACKMIQEN------------SRQAICRCQPNKFFT--SFSILMSPNTVESP---------- 383

  Fly   219 CVRKSRLSNASIPVKFSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLL-NVISLFGI 282
                                  |:|...|:      .|....|:| .|||||..|: :.::    
  Rat   384 ----------------------VLTYITYI------GLGISICSL-IICLAIEALVWSQVT---- 415

  Fly   283 FELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKF-------------QVFYKNKRSS 334
               ||.|.||.      .:....:.::::..|||  |.:..|             ..|:.:    
  Rat   416 ---KTEISYLR------HLCIANIAVTLLMADVW--FIVASFLSGPIVHHNGCVTATFFVH---- 465

  Fly   335 FFNYNIIVWSSA-------GLL--------TCIIF----------LVDQFVETNLDNPYNPAVGV 374
            ||..::..|..|       |:|        :|::.          ||...:...:..|....:..
  Rat   466 FFYLSVFFWMLAKALLILYGILIVFHTLPKSCLVASLFTVGYGCPLVIAVITLAVTEPGKGYLRP 530

  Fly   375 FSCWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYR 439
            .:||:..:...|...|..|...::::|    .:|...:.::.::                     
  Rat   531 EACWLNWDMTKALLAFVVPALAIVVVN----LITVTLVIIKTQR--------------------- 570

  Fly   440 IYFRLFIIMGGSWFLEI--IAFICEMENMWKPLIILNDYINCSQGIIIFVA--TFCNHEMFRLIR 500
                  ..:|.|.|.|:  |..||:...:..||:.|    ....||...||  :...|.:|.|  
  Rat   571 ------AAVGSSMFQEVRAIVRICKNIAILTPLLGL----TWGFGIATVVAGHSLAFHIIFSL-- 623

  Fly   501 KRIQNRNITSLELTNTSRPVESE-KMADVELGK 532
                   :.:|:::..:. :||| :...||.|:
  Rat   624 -------LNALQVSPDAM-IESEWRGCAVECGR 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 23/114 (20%)
7tmB3_Methuselah-like 236..504 CDD:320167 57/310 (18%)
TM helix 2 258..280 CDD:320167 8/22 (36%)
TM helix 3 291..318 CDD:320167 5/26 (19%)
TM helix 4 335..355 CDD:320167 7/44 (16%)
TM helix 5 383..412 CDD:320167 5/28 (18%)
TM helix 6 433..460 CDD:320167 5/28 (18%)
TM helix 7 468..493 CDD:320167 7/26 (27%)
Adgrf2XP_017452241.2 GPS 330..377 CDD:413374 12/60 (20%)
7tm_GPCRs 382..628 CDD:421689 58/347 (17%)
TM helix 1 384..409 CDD:410628 11/31 (35%)
TM helix 2 424..446 CDD:410628 4/23 (17%)
TM helix 3 458..485 CDD:410628 5/30 (17%)
TM helix 4 499..519 CDD:410628 2/19 (11%)
TM helix 5 539..568 CDD:410628 5/32 (16%)
TM helix 6 584..610 CDD:410628 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.