DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and Adgrg2

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_852031.1 Gene:Adgrg2 / 266735 RGDID:628618 Length:1013 Species:Rattus norvegicus


Alignment Length:412 Identity:80/412 - (19%)
Similarity:139/412 - (33%) Gaps:113/412 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ENLTYEYTLDITQLNGSVIKKHVLNDMVVQQDLPLPCERHYSLDAETSTYDMWSLYENGSLFRHF 173
            :|||...|:.:..:|.|            |.||.:.|.             .|.|..||......
  Rat   542 KNLTRNVTVALKHINPS------------QDDLTVKCV-------------FWDLNRNGGRGGWS 581

  Fly   174 DQRYLSKQE-----FCLQPNPTSTGKNYSLIVAFNCIQKPSMKMA-----YGRFECVRKSRLSNA 228
            ......|::     .|...:.||.|   .|:........||..||     |              
  Rat   582 SDGCSVKEKRMNETICTCSHLTSFG---ILLDLSRTSLPPSQMMALTFITY-------------- 629

  Fly   229 SIPVKFSSVFFMVITIAAYLWLPKFRS------LHGKCCNLYFICLAITFLLNVISLFGIFELKT 287
             |....||: |:.:|:..|:...|.|.      |...|..|  :.|.:.|||:  |...::..:.
  Rat   630 -IGCGLSSI-FLSVTLVTYIAFEKIRRDYPSKILIQLCAAL--LLLNLVFLLD--SWIALYNARG 688

  Fly   288 PICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCI 352
            ....:..:..|| ::.:|.|:.:.:|.::    :...:||....|.....:.|:.|....::..|
  Rat   689 FCISVAVFLHYF-LLVSFTWMGLEAFHMY----LALVKVFNTYIRKYILKFCIVGWGIPAVVVSI 748

  Fly   353 IFLVDQFVETNLDNPYNPAVGVFS----------CWIFTNGWSATFYF--YAPLAILIILNCASF 405
            :..:         :|.|..:|.:.          |||.:   |..||.  .....::.:||.:.|
  Rat   749 VLTI---------SPDNYGIGSYGKFPNGTPDDFCWINS---SVVFYITVVGYFCVIFLLNVSMF 801

  Fly   406 FLT-TRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKP 469
            .:. .:...::.|:.......:..|.|       |....|..::|.:|.....|        |.|
  Rat   802 IVVLVQLCRIKKKKQLGAQRKTSIQDL-------RSIAGLTFLLGITWGFAFFA--------WGP 851

  Fly   470 LIILNDYI----NCSQGIIIFV 487
            :.:...|:    |..||..||:
  Rat   852 VNLTFMYLFAIFNTLQGFFIFI 873

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 20/99 (20%)
7tmB3_Methuselah-like 236..504 CDD:320167 53/275 (19%)
TM helix 2 258..280 CDD:320167 7/21 (33%)
TM helix 3 291..318 CDD:320167 5/26 (19%)
TM helix 4 335..355 CDD:320167 3/19 (16%)
TM helix 5 383..412 CDD:320167 6/31 (19%)
TM helix 6 433..460 CDD:320167 5/26 (19%)
TM helix 7 468..493 CDD:320167 7/24 (29%)
Adgrg2NP_852031.1 GPS 566..608 CDD:280071 10/57 (18%)
7tm_4 621..871 CDD:304433 56/301 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.