DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and ADGRF2

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001355044.1 Gene:ADGRF2 / 222611 HGNCID:18991 Length:708 Species:Homo sapiens


Alignment Length:386 Identity:73/386 - (18%)
Similarity:129/386 - (33%) Gaps:128/386 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LNGSVIKKHVLNDMVVQQDLPLPCER------HYSLDAETSTYDM-WSLYENGSLFRHFDQRYL- 178
            |..|:::...:|.:|:...||...:|      ..|...|..|..: |...||     .:||:.. 
Human   351 LEASLLENVTVNGLVLSAILPKELKRISLIFEKISKSEERRTQCVGWHSVEN-----RWDQQACK 410

  Fly   179 -----SKQEFCLQPNPTSTGKNYSLIVAFNCIQKPSMKMAYGRFECVRKSRLSNASIPVKFSSVF 238
                 |:|..| :..|:....::|::::.:.::.                               
Human   411 MIQENSQQAVC-KCRPSKLFTSFSILMSPHILES------------------------------- 443

  Fly   239 FMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLL-NVISLFGIFELKTPICYLTGYAGYFTVM 302
             :::|...|:      .|....|:| .:||:|..|: :.::       ||.|.||. :.....:.
Human   444 -LILTYITYV------GLGISICSL-ILCLSIEVLVWSQVT-------KTEITYLR-HVCIVNIA 492

  Fly   303 ATFLWLSVISFDVWRRFAMRKF-------------QVFYKNKRSSFFNYNIIVWSSAGLL----- 349
            ||.|..     |||  |.:..|             ..|:.:    ||..::..|..|..|     
Human   493 ATLLMA-----DVW--FIVASFLSGPITHHKGCVAATFFVH----FFYLSVFFWMLAKALLILYG 546

  Fly   350 TCIIF-------LVDQFVETNLDNPY----------NPAVGVFS---CWIFTNGWSATFYFYAPL 394
            ..|:|       ||..........|.          .|..|...   ||:..:...|...|..|.
Human   547 IMIVFHTLPKSVLVASLFSVGYGCPLAIAAITVAATEPGKGYLRPEICWLNWDMTKALLAFVIPA 611

  Fly   395 AILIILNCASFFLTTRYIYVENKQNQKVLNNS---EPQKLSRNHANYRIYFRLFIIMGGSW 452
            ..::::|    .:|...:.|  |..:..:.||   |.:.:.|...|..|   |..::|.:|
Human   612 LAIVVVN----LITVTLVIV--KTQRAAIGNSMFQEVRAIVRISKNIAI---LTPLLGLTW 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 20/94 (21%)
7tmB3_Methuselah-like 236..504 CDD:320167 53/259 (20%)
TM helix 2 258..280 CDD:320167 6/22 (27%)
TM helix 3 291..318 CDD:320167 8/26 (31%)
TM helix 4 335..355 CDD:320167 7/31 (23%)
TM helix 5 383..412 CDD:320167 5/28 (18%)
TM helix 6 433..460 CDD:320167 6/20 (30%)
TM helix 7 468..493 CDD:320167
ADGRF2NP_001355044.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.