DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and ADGRG5

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001291305.1 Gene:ADGRG5 / 221188 HGNCID:19010 Length:528 Species:Homo sapiens


Alignment Length:544 Identity:92/544 - (16%)
Similarity:171/544 - (31%) Gaps:179/544 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CVCKLKTCIRFCCHHKKLMAGNLCSQDVYENLTYEYTLDITQLNGSVIKK---HVLNDMVVQQDL 141
            |:|             .|...|..::...|.|:|...:.:::...||...   |.|..|::....
Human    10 CLC-------------LLTLQNATTETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSF 61

  Fly   142 PLPCERHYSLDAETSTY---------DMWSLYENGSLFRHFDQR--------------------- 176
            |     .|:|..:|.|.         |...|....:..:...|.                     
Human    62 P-----GYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDA 121

  Fly   177 -------------YLSKQEFCLQPNPTSTGKNYSL----------------IVAF---------- 202
                         |.|...|....|.:|...||.|                .::|          
Human   122 CKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYT 186

  Fly   203 -NCI--QKPSMKMAYGRF--ECVRKSRLSNASIPVKFSSV-FFMVI------TIAAYLWLP-KFR 254
             .|:  ::.:.|..:|.:  |..|..:.|::.:..:.:.: :|.|:      .:.|.|..| .:.
Human   187 LTCVFWKEGARKQPWGGWSPEGCRTEQPSHSQVLCRCNHLTYFAVLMQLSPALVPAELLAPLTYI 251

  Fly   255 SLHGKCCNLYFICLAITFLLNV-------------------ISLFGIFELKTP----------IC 290
            ||.|  |::..:...||.||:.                   :.|..|..|.:|          .|
Human   252 SLVG--CSISIVASLITVLLHFHFRKQSDSLTRIHMNLHASVLLLNIAFLLSPAFAMSPVPGSAC 314

  Fly   291 YLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFL 355
            .....|.::.:::...|:::..|:::.... |.:.::.   |...|...::.|.:..||..:...
Human   315 TALAAALHYALLSCLTWMAIEGFNLYLLLG-RVYNIYI---RRYVFKLGVLGWGAPALLVLLSLS 375

  Fly   356 VDQFVETNLDNPYNP-AVGVFSCWIFTNG---------W-------SATFYFYAPLAILIILNCA 403
            |...|       |.| .:.||..|  .||         |       |.....|..|..|..|...
Human   376 VKSSV-------YGPCTIPVFDSW--ENGTGFQNMSICWVRSPVVHSVLVMGYGGLTSLFNLVVL 431

  Fly   404 SFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWK 468
            ::.|.|.         :::...::...:...|....: ..|.:::|.:|.|...:|...:    .
Human   432 AWALWTL---------RRLRERADAPSVRACHDTVTV-LGLTVLLGTTWALAFFSFGVFL----L 482

  Fly   469 PLIILNDYINCSQGIIIFVATFCN 492
            |.:.|...:|...|..:|: .||:
Human   483 PQLFLFTILNSLYGFFLFL-WFCS 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 29/196 (15%)
7tmB3_Methuselah-like 236..504 CDD:320167 57/311 (18%)
TM helix 2 258..280 CDD:320167 6/40 (15%)
TM helix 3 291..318 CDD:320167 3/26 (12%)
TM helix 4 335..355 CDD:320167 4/19 (21%)
TM helix 5 383..412 CDD:320167 9/44 (20%)
TM helix 6 433..460 CDD:320167 5/26 (19%)
TM helix 7 468..493 CDD:320167 7/25 (28%)
ADGRG5NP_001291305.1 GPS 187..232 CDD:307782 7/44 (16%)
7tmB2_GPR114 245..518 CDD:320559 53/291 (18%)
TM helix 1 247..272 CDD:320559 9/26 (35%)
TM helix 2 281..303 CDD:320559 3/21 (14%)
TM helix 3 315..342 CDD:320559 3/26 (12%)
TM helix 4 355..375 CDD:320559 4/19 (21%)
TM helix 5 409..438 CDD:320559 6/28 (21%)
TM helix 6 451..478 CDD:320559 5/27 (19%)
TM helix 7 482..507 CDD:320559 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.