DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and CG43968

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster


Alignment Length:356 Identity:81/356 - (22%)
Similarity:127/356 - (35%) Gaps:113/356 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FDTVQLRESE--KLCNGSYRYEDVVIPAKLTGKYDYE-IDYD--GDRVSVPKHIR-----GCVCK 83
            |||:.|....  ::.||.....|          ::.| ||||  |..|.|.|:|.     ..:..
  Fly   751 FDTLSLNNLSFTQIDNGEEHLND----------FNSETIDYDDIGVSVYVSKYILYFSIIPSIAN 805

  Fly    84 LKTCIRFCCHHKKLMAGNLCSQDVYENLTYEYTLDITQLNGSVIKKHVLNDMVVQQDLP----LP 144
            :.....|..::||.....|  :..::|..|.:    .|:|      |.:||:|.:.||.    ||
  Fly   806 VSGIALFANNNKKNTPTKL--KGAFKNEHYRF----LQVN------HNINDVVNEPDLELAAYLP 858

  Fly   145 CERHYSLDAETS-TYD---MWSLYENGSLFRHFDQRYLSKQEFCLQPNPTSTGKNYSLIVAFNCI 205
            .|...:|.|.|: |.|   :..:|.|..||:                   .:.:|.:|:      
  Fly   859 IELIDTLQASTNKTNDVIVVIKVYSNDELFQ-------------------QSVRNLTLL------ 898

  Fly   206 QKPSMKMAYGRFECVRKSRLSNASIPVKFSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAI 270
                             ||:.:.|:| .:||  |:.:.:...     ||....|..|....||..
  Fly   899 -----------------SRVVSISLP-GYSS--FLPVPVPLI-----FRKSKNKKVNPPGSCLVW 938

  Fly   271 TF--LLNVISLFGIFELKTPI--CYLTGYA--GYFTVMATFLWLSVISFDVWRRFAMRKFQVFYK 329
            .:  .::..|:...||....|  |.|...|  |||......:...:|:.|:  |.:..|      
  Fly   939 NYEGWIDGYSMLSYFENNEGIALCRLRRLAPTGYFLEKKISIENHIINHDL--RMSNTK------ 995

  Fly   330 NKRSSFFNYNIIVWSSAGLLTCIIFLVDQFV 360
                  .|.|||.   ..||:|.|.:...|:
  Fly   996 ------LNGNIIY---VILLSCCILMFIGFL 1017

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 45/192 (23%)
7tmB3_Methuselah-like 236..504 CDD:320167 31/131 (24%)
TM helix 2 258..280 CDD:320167 5/23 (22%)
TM helix 3 291..318 CDD:320167 7/28 (25%)
TM helix 4 335..355 CDD:320167 8/19 (42%)
TM helix 5 383..412 CDD:320167
TM helix 6 433..460 CDD:320167
TM helix 7 468..493 CDD:320167
CG43968NP_001262238.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.