DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and adgre14

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_021330419.1 Gene:adgre14 / 108182849 ZFINID:ZDB-GENE-131120-49 Length:505 Species:Danio rerio


Alignment Length:493 Identity:96/493 - (19%)
Similarity:168/493 - (34%) Gaps:148/493 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RFCCHHKKLMAGNLCSQDVYENLTYEYTLDITQLNGSV--IKKHVLNDMVVQQDLPLPCERHYSL 151
            |...::::||:..:...|...|:::    .:..:.|.|  :..||..|     ::|....|:.|:
Zfish    27 RVLINNEELMSTLVKQTDTSANVSF----TLADVEGRVFMVGPHVTLD-----EIPRLHTRNCSI 82

  Fly   152 DAETSTYDMWSLYENGS-------LFRHFD-QRYLSKQEF-----------------CLQPNPTS 191
            |     .|:..:..|.:       :|..:: ...|.|.:|                 ...|..|:
Zfish    83 D-----IDLIGIANNNNGTRSAAVIFLGYNTMENLLKADFFNATNDTVNTMMSSVISVTLPKTTN 142

  Fly   192 TGKNYSLIVAFNCIQK--PSMKMAYGRFECV---------------RKSR--------------- 224
            |..:..:...|..|::  ||     |.|.||               ..:|               
Zfish   143 TALSKPVNFTFRHIREFDPS-----GSFSCVYWNISKWIVDGCSVLNTNRSFTVCSCVHLSTFAL 202

  Fly   225 -LSNASIPVKFSS--------------VFF--MVITIAAYLWLPKFRSLH--GKCCNLYFICLAI 270
             :...|.|.:..|              :||  .::|.....|.|...::.  ..|.:|  :...:
Zfish   203 IMQTRSHPPESDSLLNVLNVVCVIVGLLFFSLALLTFTRCQWSPGVNNVARINICISL--LLAHL 265

  Fly   271 TFLLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWL---SVISFDVWRRFAMRKFQV--FYKN 330
            .|||.. ....:...:..:|.|.....:|..::.|:|:   :|:.|...:..:....|:  ..:|
Zfish   266 LFLLTQ-QFLSLIRRQKVLCMLISGLLHFLFLSGFVWMFIEAVLLFICVKNLSQISSQMKNVLRN 329

  Fly   331 KRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNP-AVGVFSCWIFTNG---WSATFYFY 391
            |                 |.|:|......|..::.....| ..|...|||..:.   ||    |.
Zfish   330 K-----------------LLCVIGYAVALVVVSISAAVVPNGYGSEKCWIQMHKGFIWS----FL 373

  Fly   392 APLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRL---FIIMGGSWF 453
            .|:.|:|.||...|.    .|....|...|.| |::..:|::...   :.|:.   |:::|.||.
Zfish   374 GPVTIIIALNVILFI----SIGFSLKSAFKKL-NADVSQLNQTKI---VMFKTLAQFVVLGCSWI 430

  Fly   454 LEIIAFICEMENMWKPLIILNDYINCSQGIIIFVATFC 491
            |....      |..|.|.||...:|..||..||: .:|
Zfish   431 LGFFT------NSSKVLEILFLILNSQQGTFIFL-IYC 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 24/141 (17%)
7tmB3_Methuselah-like 236..504 CDD:320167 62/286 (22%)
TM helix 2 258..280 CDD:320167 5/21 (24%)
TM helix 3 291..318 CDD:320167 6/29 (21%)
TM helix 4 335..355 CDD:320167 3/19 (16%)
TM helix 5 383..412 CDD:320167 9/31 (29%)
TM helix 6 433..460 CDD:320167 6/29 (21%)
TM helix 7 468..493 CDD:320167 10/24 (42%)
adgre14XP_021330419.1 GPS 167..205 CDD:197639 3/37 (8%)
7tm_GPCRs 214..476 CDD:333717 62/287 (22%)
TM helix 1 217..241 CDD:320095 3/23 (13%)
TM helix 2 250..271 CDD:320095 5/22 (23%)
TM helix 3 285..307 CDD:320095 4/21 (19%)
TM helix 4 331..347 CDD:320095 4/15 (27%)
TM helix 5 365..388 CDD:320095 8/26 (31%)
TM helix 6 412..435 CDD:320095 6/25 (24%)
TM helix 7 439..464 CDD:320095 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.