DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and adgrg2a

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005162818.2 Gene:adgrg2a / 101882832 ZFINID:ZDB-GENE-140106-206 Length:2289 Species:Danio rerio


Alignment Length:272 Identity:63/272 - (23%)
Similarity:106/272 - (38%) Gaps:52/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 SVFFMVITIAAYLWLPKF-RSLHGKCCNLYFICLAITFLLNVISLFGIFELKTP---ICYLTGYA 296
            |..|:.:|:..||...|. |.:..|.  |..:|.|:.||..|..|.....|.|.   :|..|.:.
Zfish  1942 SAIFLSVTLLTYLSFDKIRRDIPSKI--LIHLCFALLFLNLVFLLDSWLALYTDAVGLCISTAFF 2004

  Fly   297 GYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVE 361
            .::.::.:|.|:.:.:..::    :...:||..........:::|.|   |:...::.:|   :.
Zfish  2005 LHYFLLVSFTWMGLEALHMY----LAIVKVFNNFMSRYMLKFSLIGW---GVPLAVVIIV---IA 2059

  Fly   362 TNLDNPYNPAVGVFS-------CWIFTNGWSATFY--FYAPLAILIILNCASFFLT---TRYIYV 414
            .|.||....:.|.||       ||:..   |..||  ..|...|:.:||.|.|.:.   .|.|..
Zfish  2060 INKDNYGLISYGKFSDGTTDDFCWLKN---STAFYVAVVAYFCIIFVLNLAMFVVVMVHLRRIKR 2121

  Fly   415 ENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYI-- 477
            .|..|.:..:..:         :.|....|..::|.:|.....|        |.|:.:...|:  
Zfish  2122 RNPHNNQYRSGVQ---------DLRSIAGLTFLLGLTWGFAFFA--------WGPVNLAFTYLFS 2169

  Fly   478 --NCSQGIIIFV 487
              ||.||..|||
Zfish  2170 IFNCLQGFFIFV 2181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923
7tmB3_Methuselah-like 236..504 CDD:320167 63/272 (23%)
TM helix 2 258..280 CDD:320167 7/21 (33%)
TM helix 3 291..318 CDD:320167 3/26 (12%)
TM helix 4 335..355 CDD:320167 3/19 (16%)
TM helix 5 383..412 CDD:320167 10/33 (30%)
TM helix 6 433..460 CDD:320167 5/26 (19%)
TM helix 7 468..493 CDD:320167 9/24 (38%)
adgrg2aXP_005162818.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.