DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and ADGRG2

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001073327.1 Gene:ADGRG2 / 10149 HGNCID:4516 Length:1017 Species:Homo sapiens


Alignment Length:412 Identity:81/412 - (19%)
Similarity:142/412 - (34%) Gaps:115/412 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NLTYEYTLDITQLNGSVIKKHVLNDMVVQQDLPLPCERHYSLDAETSTYDMWSLYENGSLFRHFD 174
            |||...|:.:..:|.|            |.:|.:.|.             .|.|..||......|
Human   547 NLTRNVTVTLKHINPS------------QDELTVRCV-------------FWDLGRNGGRGGWSD 586

  Fly   175 ------QRYLSKQEFCLQPNPTSTGKNYSLIVAFNCIQKPSMKMA-----YGRFECVRKSRLSNA 228
                  .|.|: :..|...:.||.|   .|:........|:..||     |              
Human   587 NGCSVKDRRLN-ETICTCSHLTSFG---VLLDLSRTSVLPAQMMALTFITY-------------- 633

  Fly   229 SIPVKFSSVFFMVITIAAYLWLPKFRS------LHGKCCNLYFICLAITFLLNVISLFGIFELKT 287
             |....||: |:.:|:..|:...|.|.      |...|..|  :.|.:.|||:  |...::::: 
Human   634 -IGCGLSSI-FLSVTLVTYIAFEKIRRDYPSKILIQLCAAL--LLLNLVFLLD--SWIALYKMQ- 691

  Fly   288 PICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCI 352
            .:|.......::.::.:|.|:.:.:|.::    :...:||....|.....:.|:.|....::..|
Human   692 GLCISVAVFLHYFLLVSFTWMGLEAFHMY----LALVKVFNTYIRKYILKFCIVGWGVPAVVVTI 752

  Fly   353 IFLVDQFVETNLDNPYNPAVGVFS----------CWIFTNGWSATFYF--YAPLAILIILNCASF 405
            |..:         :|.|..:|.:.          |||..|   |.||.  .....::.:||.:.|
Human   753 ILTI---------SPDNYGLGSYGKFPNGSPDDFCWINNN---AVFYITVVGYFCVIFLLNVSMF 805

  Fly   406 FLT-TRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKP 469
            .:. .:...::.|:.......:..|.|       |....|..::|.:|.....|        |.|
Human   806 IVVLVQLCRIKKKKQLGAQRKTSIQDL-------RSIAGLTFLLGITWGFAFFA--------WGP 855

  Fly   470 LIILNDYI----NCSQGIIIFV 487
            :.:...|:    |..||..||:
Human   856 VNVTFMYLFAIFNTLQGFFIFI 877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 21/99 (21%)
7tmB3_Methuselah-like 236..504 CDD:320167 54/275 (20%)
TM helix 2 258..280 CDD:320167 7/21 (33%)
TM helix 3 291..318 CDD:320167 3/26 (12%)
TM helix 4 335..355 CDD:320167 4/19 (21%)
TM helix 5 383..412 CDD:320167 6/31 (19%)
TM helix 6 433..460 CDD:320167 5/26 (19%)
TM helix 7 468..493 CDD:320167 7/24 (29%)
ADGRG2NP_001073327.1 GPS 569..612 CDD:280071 12/59 (20%)
7tm_4 625..875 CDD:304433 57/301 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.