DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste12DOR and CKB1

DIOPT Version :9

Sequence 1:NP_727747.3 Gene:Ste12DOR / 117463 FlyBaseID:FBgn0044817 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_199519.1 Gene:CKB1 / 834754 AraportID:AT5G47080 Length:287 Species:Arabidopsis thaliana


Alignment Length:171 Identity:74/171 - (43%)
Similarity:103/171 - (60%) Gaps:17/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEILDVILKPVIDSSSG 61
            :|.|...::|||.||..::||:|.|.|..||:||.||..||.    |:...||:||.  ::||.|
plant    91 VSGSDGEDTSWISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSLVPYYEYALDLILD--VESSQG 153

  Fly    62 LLYGDEKK---------WYGMIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGVSA 117
            .::.:|:.         .||:||||||.:.:||.||..||...|||.||.:.|..|..||||.|.
plant   154 EMFTEEQNELIESAAEMLYGLIHARYILTSKGLAAMLDKYKNYDFGRCPRVYCCGQPCLPVGQSD 218

  Fly   118 VWGKSTVKIHCPRCKSNFHPKSDTQ--LDGAMFGPSFPDIF 156
            :...|||||:||:|:..::|:|..|  :|||.||.:||.:|
plant   219 LPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLF 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste12DORNP_727747.3 CK_II_beta 11..166 CDD:198153 71/161 (44%)
CKB1NP_199519.1 CK_II_beta 100..283 CDD:395970 72/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.