DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste12DOR and CKB3

DIOPT Version :9

Sequence 1:NP_727747.3 Gene:Ste12DOR / 117463 FlyBaseID:FBgn0044817 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_191584.1 Gene:CKB3 / 825196 AraportID:AT3G60250 Length:276 Species:Arabidopsis thaliana


Alignment Length:178 Identity:74/178 - (41%)
Similarity:105/178 - (58%) Gaps:17/178 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEILDVILKPVIDSSSG 61
            :|.|:.:::|||.||..::||.|.|.|..||:||.||..||.    |:...||:||.  :|:|:.
plant    80 VSGSEGDDTSWISWFCNLRGNDFFCEVDEDYIQDDFNLCGLSGQVPYYDYALDLILD--VDASNS 142

  Fly    62 LLYGDE---------KKWYGMIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGVSA 117
            .::.||         :..||:||.|||.:.:|:.||..||...|||.||.:.|..|:.||||.|.
plant   143 EMFTDEQHEMVESAAEMLYGLIHVRYILTTKGMAAMTEKYKNCDFGRCPRVFCCGQSCLPVGQSD 207

  Fly   118 VWGKSTVKIHCPRCKSNFHPKSDTQ--LDGAMFGPSFPDIFFSMLPNL 163
            :...|||||:||:|:...:|:|..|  :|||.||.:||.:|.....||
plant   208 IPRSSTVKIYCPKCEDISYPRSKFQGNIDGAYFGTTFPHLFLMTYGNL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste12DORNP_727747.3 CK_II_beta 11..166 CDD:198153 71/168 (42%)
CKB3NP_191584.1 CK_II_beta 89..272 CDD:395970 72/169 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.