DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste12DOR and Ssl

DIOPT Version :9

Sequence 1:NP_727747.3 Gene:Ste12DOR / 117463 FlyBaseID:FBgn0044817 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_523848.2 Gene:Ssl / 37909 FlyBaseID:FBgn0015300 Length:219 Species:Drosophila melanogaster


Alignment Length:157 Identity:88/157 - (56%)
Similarity:109/157 - (69%) Gaps:2/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLEYFSEILDVILKPVIDSSSGLLYGDEKKWYG 72
            :.|||||||||||::|.||||.:|:||.||..|||:.|:.|:|:|.|..|:..... .:|||.||
  Fly    11 DGSWIDWFLGIKGHEFSCRVPNEYIQDKFNLTGLEFDSQTLEVVLDPEFDNEDWDC-AEEKKLYG 74

  Fly    73 MIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGVSAVWGKSTVKIHCPRCKSNFHP 137
            |||||||.|.||:..|..||.||||||||.:.|.||..||||:..||.|:.|||:||.|.:.:.|
  Fly    75 MIHARYIVSPRGIEDMRLKYERGDFGSCPRVFCKRQKVLPVGLHDVWDKAQVKIYCPSCNNVYIP 139

  Fly   138 -KSDTQLDGAMFGPSFPDIFFSMLPNL 163
             ..:..|||||||.|||.:||..||:|
  Fly   140 LPHNGMLDGAMFGTSFPHMFFMQLPSL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste12DORNP_727747.3 CK_II_beta 11..166 CDD:198153 87/154 (56%)
SslNP_523848.2 CK_II_beta 13..183 CDD:198153 88/155 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448600
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 1 1.000 - - FOG0005928
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.