DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste12DOR and CkIIbeta2

DIOPT Version :9

Sequence 1:NP_727747.3 Gene:Ste12DOR / 117463 FlyBaseID:FBgn0044817 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster


Alignment Length:177 Identity:65/177 - (36%)
Similarity:100/177 - (56%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFN----QMGLEYFSEILDVIL------------ 52
            :.::.||||.||...:||:|.|.|..:|:||.||    ...::.:...|:|||            
  Fly     2 TDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASEDPA 66

  Fly    53 KPVIDSSSGLLYGDEKKWYGMIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGVSA 117
            :|.:::|:       :|.||:||||:|.:.||:..|..||.:|:||:||...|..|..||:|:|.
  Fly    67 EPELEASA-------EKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSD 124

  Fly   118 VWGKSTVKIHCPRCKSNFHPKSD--TQLDGAMFGPSFPDIFFSMLPN 162
            ..|:..|:|:||:|...:.||:.  :.||||.||..||.:||...|:
  Fly   125 NPGEDMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste12DORNP_727747.3 CK_II_beta 11..166 CDD:198153 63/170 (37%)
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 63/170 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448616
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.