DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste12DOR and CSNK2B

DIOPT Version :9

Sequence 1:NP_727747.3 Gene:Ste12DOR / 117463 FlyBaseID:FBgn0044817 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001311.3 Gene:CSNK2B / 1460 HGNCID:2460 Length:215 Species:Homo sapiens


Alignment Length:174 Identity:73/174 - (41%)
Similarity:102/174 - (58%) Gaps:15/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEILDVILKPVID---- 57
            ||||:  ..|||.||.|::||:|.|.|..||:||.||..||.    ::.:.||:||....|    
Human     1 MSSSE--EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELE 63

  Fly    58 ---SSSGLLYGDEKKWYGMIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGVSAVW 119
               :.|.|:....:..||:||||||.:.||:..|..||.:||||.||.:.|:.|..||:|:|.:.
Human    64 DNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

  Fly   120 GKSTVKIHCPRCKSNFHPKSDT--QLDGAMFGPSFPDIFFSMLP 161
            |::.||::||:|...:.|||..  ..|||.||..||.:.|.:.|
Human   129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste12DORNP_727747.3 CK_II_beta 11..166 CDD:198153 68/164 (41%)
CSNK2BNP_001311.3 CK_II_beta 8..191 CDD:198153 69/165 (42%)
Interaction with alpha subunit. /evidence=ECO:0000250 188..193
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.