DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TotZ and TotB

DIOPT Version :10

Sequence 1:NP_536782.2 Gene:TotZ / 117459 FlyBaseID:FBgn0044809 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_524422.1 Gene:TotB / 42474 FlyBaseID:FBgn0038838 Length:138 Species:Drosophila melanogaster


Alignment Length:108 Identity:28/108 - (25%)
Similarity:51/108 - (47%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSFVLAVLICLTGNGSARMLDADRNRLQQLQIRSQQSADANTQVDIAYEVIGIYDKYKGQGGSNV 71
            :.|.|.::..|....|.:....|..|:.::.   :.|.|.||::....|::.||::.     :..
  Fly     8 ICFALLLIGTLCSAYSNQERQRDSRRVAEIM---RTSWDDNTKIKRIQELLTIYNRM-----APS 64

  Fly    72 LR---EAQLNSQVNDFKRKTMVIDGVPAQGGVWGILGAIKKAA 111
            ||   .|:::..::.:..:.|| ||||:|||...|...|...|
  Fly    65 LRPDERARMDRFISGYTGEIMV-DGVPSQGGARRIFKKILSPA 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TotZNP_536782.2 Turandot 43..121 CDD:399906 22/72 (31%)
TotBNP_524422.1 Turandot 41..116 CDD:399906 22/72 (31%)

Return to query results.
Submit another query.