DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and MRP2

DIOPT Version :9

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_015492.1 Gene:MRP2 / 856295 SGDID:S000006370 Length:115 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:29/108 - (26%)
Similarity:55/108 - (50%) Gaps:4/108 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRTK----YADWKMIRDVKRRKCVKENAVERLRVNSLRKNDILPPELREVADAEIAAFPRDSSLV 85
            ::||    :.:.:::||..:|:..|||.:....:..:.:|..||.:||..|..::.|.|......
Yeast     8 IKTKLPPGFINARILRDNFKRQQFKENEILVKSLKFIARNMNLPTKLRLEAQLKLNALPNYMRST 72

  Fly    86 RVRERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW 128
            :::.||..:...|.|:..:||.|..:|..|....|.||::.:|
Yeast    73 QIKNRCVDSGHARFVLSDFRLCRYQFRENALKGNLPGVKKGIW 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 26/91 (29%)
MRP2NP_015492.1 Ribosomal_S14 61..112 CDD:395195 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0199
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I1873
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003806
OrthoInspector 1 1.000 - - oto99312
orthoMCL 1 0.900 - - OOG6_102116
Panther 1 1.100 - - LDO PTHR19836
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1255
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.