DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and mrps14

DIOPT Version :9

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001038823.1 Gene:mrps14 / 751639 ZFINID:ZDB-GENE-060825-75 Length:138 Species:Danio rerio


Alignment Length:127 Identity:70/127 - (55%)
Similarity:93/127 - (73%) Gaps:7/127 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GFVCQSVQIA--GCG-----LQQVRTKYADWKMIRDVKRRKCVKENAVERLRVNSLRKNDILPPE 66
            ||:..|:..:  .|.     ::|||:.|.||:|:||||||:...|.|..|||:|::.||.|||.|
Zfish    12 GFLHSSLSFSRQACRSPVAVMEQVRSYYVDWRMLRDVKRRQMAFEYADTRLRINAIGKNTILPKE 76

  Fly    67 LREVADAEIAAFPRDSSLVRVRERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW 128
            |:|:||.||||.||||..||:|.||.||||||.|..::||||||:|.|||::::|||||:||
Zfish    77 LQEIADKEIAALPRDSCPVRIRNRCVLTSRPRAVKRRWRLSRIVFRDLADHSQMSGVQRSMW 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 57/91 (63%)
mrps14NP_001038823.1 Ribosomal_S14 46..138 CDD:294254 57/91 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592417
Domainoid 1 1.000 71 1.000 Domainoid score I9463
eggNOG 1 0.900 - - E1_COG0199
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41467
Inparanoid 1 1.050 142 1.000 Inparanoid score I4460
OMA 1 1.010 - - QHG48790
OrthoDB 1 1.010 - - D1612572at2759
OrthoFinder 1 1.000 - - FOG0003806
OrthoInspector 1 1.000 - - oto41412
orthoMCL 1 0.900 - - OOG6_102116
Panther 1 1.100 - - LDO PTHR19836
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1255
SonicParanoid 1 1.000 - - X6370
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.