DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and CG32533

DIOPT Version :9

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001285437.1 Gene:CG32533 / 32933 FlyBaseID:FBgn0052533 Length:1139 Species:Drosophila melanogaster


Alignment Length:84 Identity:19/84 - (22%)
Similarity:40/84 - (47%) Gaps:14/84 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TKYADWKMIRDVKR---------RKCVKENAVERLRVNSLRKNDILPPELREVADAEIAAFPRDS 82
            |::.:.:.::.:||         ||.:|::| .|:..:...:.:....::|:| |..:...||..
  Fly   706 TRHGELRQLKAMKRRQRFEQPRQRKLLKQSA-GRVAEDEEEQEEAQGDDMRDV-DFRLRFDPRQL 768

  Fly    83 SLVRVRERCALTSRPRGVV 101
            :|:   ||.:...|...||
  Fly   769 ALL---ERSSRLDRHSVVV 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 18/75 (24%)
CG32533NP_001285437.1 DEXDc 155..327 CDD:214692
DEXDc 163..298 CDD:238005
Helicase_C 358..490 CDD:278689
HA2 560..640 CDD:214852
OB_NTP_bind <792..897 CDD:285018
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0199
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.