DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and Mrps14

DIOPT Version :9

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001099433.1 Gene:Mrps14 / 289143 RGDID:1309432 Length:128 Species:Rattus norvegicus


Alignment Length:116 Identity:73/116 - (62%)
Similarity:89/116 - (76%) Gaps:2/116 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QSVQIAGCGLQQVRTKYADWKMIRDVKRRKCVKENAVERLRVNSLRKNDILPPELREVADAEIAA 77
            |:|.::..|  |.|..|.||:|:|||||||...|.|.||||:||||||.|||.:|:|:|..||||
  Rat    15 QAVPLSSSG--QARGYYVDWRMLRDVKRRKMAYEYADERLRINSLRKNTILPKDLQEMAGDEIAA 77

  Fly    78 FPRDSSLVRVRERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW 128
            .||||..||:|.||.:|||||||..::||||||:|||||:..|||||||:|
  Rat    78 LPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGLLSGVQRAIW 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 63/91 (69%)
Mrps14NP_001099433.1 Ribosomal_S14 74..126 CDD:395195 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350700
Domainoid 1 1.000 77 1.000 Domainoid score I8700
eggNOG 1 0.900 - - E1_COG0199
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41467
Inparanoid 1 1.050 144 1.000 Inparanoid score I4362
OMA 1 1.010 - - QHG48790
OrthoDB 1 1.010 - - D1612572at2759
OrthoFinder 1 1.000 - - FOG0003806
OrthoInspector 1 1.000 - - oto96376
orthoMCL 1 0.900 - - OOG6_102116
Panther 1 1.100 - - LDO PTHR19836
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6370
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.