DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and mrp2

DIOPT Version :9

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_593797.1 Gene:mrp2 / 2541862 PomBaseID:SPAC23H3.07c Length:105 Species:Schizosaccharomyces pombe


Alignment Length:96 Identity:34/96 - (35%)
Similarity:50/96 - (52%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KMIRDVKRRKCVKENAVERLRVNSLRKNDILPPELREVADAEIAAFPRDSSLVRVRERCALTSRP 97
            |..||:..|:...|:.|||.....:.:|..||..:|..|...|.|.|.::...:::.||..|.|.
pombe    10 KAFRDLLCRRLFAEHEVERQSNLYIYRNPELPLRVRLEAKKRIEALPTNAHPTKIKNRCIETGRG 74

  Fly    98 RGVVHKYRLSRIVWRHLADYNKLSGVQRAMW 128
            |||...:.|:|..:|..|..|||.||::|.|
pombe    75 RGVFRAFGLARFPFRLKALANKLPGVRKASW 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 32/91 (35%)
mrp2NP_593797.1 Ribosomal_S14 54..104 CDD:278673 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0199
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2014
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003806
OrthoInspector 1 1.000 - - oto100888
orthoMCL 1 0.900 - - OOG6_102116
Panther 1 1.100 - - LDO PTHR19836
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1255
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.