DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and mrps14

DIOPT Version :9

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_002931484.1 Gene:mrps14 / 100485757 XenbaseID:XB-GENE-975794 Length:131 Species:Xenopus tropicalis


Alignment Length:105 Identity:76/105 - (72%)
Similarity:85/105 - (80%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QVRTKYADWKMIRDVKRRKCVKENAVERLRVNSLRKNDILPPELREVADAEIAAFPRDSSLVRVR 88
            |||..|.||:|.|||||||...|.|.||||||:||||.|||.|||||||.||||||.||..||:|
 Frog    27 QVRNYYVDWRMFRDVKRRKMAYEYADERLRVNALRKNIILPKELREVADKEIAAFPVDSCPVRIR 91

  Fly    89 ERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW 128
            .||.||||||||..::||||||:|||||.|::||:|||||
 Frog    92 NRCVLTSRPRGVKRRWRLSRIVFRHLADNNQMSGIQRAMW 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 67/91 (74%)
mrps14XP_002931484.1 Ribosomal_S14 39..131 CDD:381968 67/91 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8746
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41467
Inparanoid 1 1.050 152 1.000 Inparanoid score I4243
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612572at2759
OrthoFinder 1 1.000 - - FOG0003806
OrthoInspector 1 1.000 - - oto103088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1255
SonicParanoid 1 1.000 - - X6370
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.