DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:279 Identity:62/279 - (22%)
Similarity:105/279 - (37%) Gaps:81/279 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACCFN-YKFVLNLCNFLFLICGLLLVVSGLYIFS-----DNKRILLSRLLAASSDRLSSLPQPL 59
            |:|..: .|::|.:.|.|..|||:||:|.|..:||     |:         .|.:.|...:|..:
  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDD---------FAEALRTQQVPVTM 56

  Fly    60 LFYIALGVAIAGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWP------ 118
            :        |.|.:..|.:..|...:...:||....|.:.:.||::.:  |.|.|.:|.      
  Fly    57 I--------ILGTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQ--LALVIYMWVQKDKYL 111

  Fly   119 HCLGISLDETQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNW 183
            ..:|..:::....|:.:|:|           :|..|:...|||.....||     ..||      
  Fly   112 EIMGDVVEKAWNHRTSRSDY-----------MDAIQISMKCCGRSGYTDY-----AYQG------ 154

  Fly   184 PVPLSCCFLKNAGHSMAYLDPKPANESMCQSLERLSYERERHTESC-LPHLDNWYREQYSIFLGA 247
            ..|.|||              ...|....:::.|         ..| :..::.|.|.. .|...|
  Fly   155 KFPPSCC--------------SDTNNCRWETVYR---------RGCKVTFVEFWDRNS-DIIKYA 195

  Fly   248 SLILAMIEFCVLLAIIMSC 266
            .|::|.|||   :..:.:|
  Fly   196 GLVIAAIEF---VGFVFAC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 60/271 (22%)
tetraspanin_LEL 117..241 CDD:239401 23/130 (18%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 60/272 (22%)
tetraspanin_LEL 104..188 CDD:239401 22/128 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.