DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp74F

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:277 Identity:64/277 - (23%)
Similarity:108/277 - (38%) Gaps:65/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACCFNY-KFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLF--- 61
            |.||..: |:.|.:.||:..:.|.::....|:...|  |..::.||..:           ||   
  Fly     7 MDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVD--RSFVNELLGTN-----------LFSGA 58

  Fly    62 -YIALGVAIAGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISL 125
             |:.|   :...:..|.:.:|...:.....|.|..||:.|.::.:|        .|....||...
  Fly    59 VYVLL---VTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVT--------MLIGGVLGYVF 112

  Fly   126 DE------TQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWP 184
            .|      .|.:||..:.||  .:.:.|.|.||.|.|..|||:.:..|::.       ||    |
  Fly   113 RERVQQTMRQEMRSTMALYG--SRREITQAWDLTQERLQCCGVDTWHDWNR-------YG----P 164

  Fly   185 VPLSCCFLKNAGHSMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYREQYSIFLGASL 249
            ||.|||.....|           ....|.....::   ..:.:.||....|:.|:..::..|.|:
  Fly   165 VPESCCQELFGG-----------QRKECTIFPTIT---NLYNQGCLYVTTNFIRDHAAVIGGTSI 215

  Fly   250 ILAMIEFCVLLAIIMSC 266
            .:|::   ::..:|.||
  Fly   216 AVAIL---MIFGMIFSC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 61/269 (23%)
tetraspanin_LEL 117..241 CDD:239401 32/129 (25%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 61/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.