DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp47F

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:275 Identity:60/275 - (21%)
Similarity:118/275 - (42%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KFVLNLCNFLFLICGLLLVVSGLYIFSD-NK--RILLSRLLAASSDRLSSLPQPLLFYIALGVAI 69
            |:||...|.||.|.||.::::|..:.:| |:  ..:..|:||          .|::      :.:
  Fly    10 KYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLA----------PPIV------LIV 58

  Fly    70 AGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVRSL 134
            .|.:..|.|.:|.:.:...:...|..:.:.:.|:.:.|..:.:|.:::...|     |..:..||
  Fly    59 TGLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDL-----EGMVKNSL 118

  Fly   135 QSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFLKNAGHSM 199
            |.:......|. |.|.|..|.:..|||:.|..|     ||..   ..|..:|.|||         
  Fly   119 QESIKRSNSED-TMAWDNIQQKLMCCGVDSPAD-----WRTL---SANKTLPGSCC--------- 165

  Fly   200 AYLDPKPANESMCQSLERLSYERERHTE-SCLPHLDNWYREQYSIFLGASLILAMIEFCVLLAII 263
               .|:..:.::...||..:..::::.: .|:..|.:...:...|.:|..:.:|.|:   :|.|:
  Fly   166 ---QPQYIDSTVGHCLESPALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQ---ILGIV 224

  Fly   264 MSC---TGLASQRAR 275
            ::|   ..:..:||:
  Fly   225 LACYLANSIRQERAK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 58/265 (22%)
tetraspanin_LEL 117..241 CDD:239401 27/124 (22%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 58/267 (22%)
uroplakin_I_like_LEL 102..205 CDD:239409 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.