DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42Er

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:274 Identity:51/274 - (18%)
Similarity:100/274 - (36%) Gaps:77/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIALGVAIA-G 71
            :::..|.|||..:.|:..:|..:        |.:.::  |..|:|           .||:.|| |
  Fly     9 RYLAFLFNFLCAVLGIATIVVNV--------IAIDQI--APKDQL-----------ILGLYIAVG 52

  Fly    72 FVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVRSLQS 136
            .:..|.:..|.:.:...:.|....|..|::|:|:...|:.....:  |....|:.:.:...:.|:
  Fly    53 SIVFLLSFFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRM--HFEEDSITKLKQAFAKQT 115

  Fly   137 NYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFLKNAGHSMAY 201
            |        ..:|:...|.::.|||          :::|:.||.....||.||            
  Fly   116 N--------TFDAMAEYQTQYQCCG----------IYKLKDYGDAYITVPSSC------------ 150

  Fly   202 LDPKPANESMCQSLERLSYERE--RHTESCLPHLDNWYREQYSIFLGASLILAMIEFCVLLAIIM 264
                              |::.  .:.:.||..::..|.|   :..|..::..|:....:.|...
  Fly   151 ------------------YDQNDTPYRDGCLAKMETQYEE---LLKGPKIVGWMLMVIEIGAFTF 194

  Fly   265 SCTGLASQRARLKK 278
            |.....|.|..|::
  Fly   195 STIMGVSLRNELRR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 48/261 (18%)
tetraspanin_LEL 117..241 CDD:239401 21/125 (17%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 47/259 (18%)
tetraspanin_LEL 93..174 CDD:239401 21/133 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.