DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42Eq

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster


Alignment Length:200 Identity:37/200 - (18%)
Similarity:70/200 - (35%) Gaps:67/200 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYI--ALGVAIAG 71
            |||:     ||.|                 :|.:..:||.|..|.:....:...:  .||:.:.|
  Fly    13 FVLD-----FLCC-----------------VLAALTIAACSYALIAFSHSVAIRVPSILGIVLGG 55

  Fly    72 FVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVRSLQS 136
            .: ..:.:.|..|:...:.....||...::.|:.::..:.||..:                    
  Fly    56 LL-FFSTIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPI-------------------- 99

  Fly   137 NYGV----------PGQEQFTNALDLAQVRFGCCGMRSSLDY-DTSLWRLQGYGQRNWPVPLSCC 190
            ||.:          .||...::.:...::::.|||.....:| |:.|           .:|.||.
  Fly   100 NYELLANETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPDSGL-----------VIPQSCY 153

  Fly   191 FLKNA 195
            |.:||
  Fly   154 FNQNA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 36/199 (18%)
tetraspanin_LEL 117..241 CDD:239401 15/89 (17%)
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 36/199 (18%)
tetraspanin_LEL 95..173 CDD:239401 17/94 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.