DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:317 Identity:56/317 - (17%)
Similarity:107/317 - (33%) Gaps:91/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CFN-YKFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIALGV 67
            |:| .|:...|.|.|:::.| :.|:||                |....:::....|...|....:
  Fly     4 CYNTIKYTGLLSNLLYMLLG-IGVMSG----------------AGLGLQMAEPNTPEHTYFVKSL 51

  Fly    68 AIAGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVR 132
            .:.|.:. :..:.|.:....:..|...|:.:.:::.|..|            .|.:....:..:|
  Fly    52 VLGGSIC-MIVMFGCYGMVANLLCVNLIFTMFILIALAAE------------YLQLHHYHSPSLR 103

  Fly   133 S-------LQ-SNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSC 189
            |       |: :.:|:....:..:..:.:|   .|||...:.||.    ||      :..||.| 
  Fly   104 SPGGAWQQLELAWHGLDRDPELMHQYEASQ---HCCGYNGADDYK----RL------HLLVPAS- 154

  Fly   190 CFLKNAGHSMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYREQYSIFLGASLILAMI 254
            |:......:...:.|....|::.:| :|....|::        |..|......||    ::|..:
  Fly   155 CYQAAVNDTAQQIYPSGCLETLNRS-QRYIQHRDK--------LYMWAIVGLEIF----ILLQTV 206

  Fly   255 EFCVLLAIIMSCTGLASQRARLKKPVQEMRTQKVKSRQTLIENIYEPDVELRENSNH 311
            ...|||.                         :::.||.:......|.|.....|||
  Fly   207 ALSVLLF-------------------------RLRQRQRIARRQVPPGVRREPRSNH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 47/266 (18%)
tetraspanin_LEL 117..241 CDD:239401 24/131 (18%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 35/201 (17%)
tetraspanin_LEL 91..183 CDD:239401 21/106 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.