DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and lbm

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:246 Identity:55/246 - (22%)
Similarity:93/246 - (37%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AASSDRLSSLPQPLLFYIALGVAIAGFVATLA---------AVVGFWASC--LHTYCFLTIY--F 97
            |.:|.:::|    ::....||...||.:..:|         .|:..:.:|  :..:..|.|:  .
  Fly     4 ATTSVKIAS----IVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLGIFAAI 64

  Fly    98 LSVVVLLLTESVLCLAITLW---PHCLGISLDETQMVRSLQSNYGVPGQEQFTNALDLAQVRFGC 159
            ...|||..|.:|..|.:.:.   ..||  .|.|.. |:|.:....|..|   .|.:|..|.:..|
  Fly    65 RESVVLTATSAVFLLILAILQIVSTCL--FLHEFD-VKSGRDMVEVAWQ---ANNMDSLQQKHEC 123

  Fly   160 CGMRSSLDY-DTSLWRLQGYGQRNWPVPLSCCFLKNAGHSMAYLDPKPANESMCQSLERLSYERE 223
            ||..|:.|| ..||.           :|.||           |.|       :.|:.:.|     
  Fly   124 CGQSSAQDYIHLSLL-----------IPPSC-----------YAD-------LQQTPDHL----- 154

  Fly   224 RHTESCLPHLDNWYREQYSIFLGASLILAMIE-FCVLLAIIMSCTGLASQR 273
             :.:.|:..:.::|......|:..|.:|...| .|..||:.::.:....||
  Fly   155 -YLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLAISFKNKQR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 53/238 (22%)
tetraspanin_LEL 117..241 CDD:239401 28/127 (22%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 51/234 (22%)
tetraspanin_LEL <109..169 CDD:239401 21/97 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.