DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42El

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:292 Identity:60/292 - (20%)
Similarity:99/292 - (33%) Gaps:114/292 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACCF-NYKFVLNLCNFLFLICGLL-LVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYI 63
            |.|.. ..|:.|.|.|.|:.|.|:| |:..||                    ...::|..    .
  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGL--------------------GWGAMPDA----Y 41

  Fly    64 ALGVAIAGFVATLAAVVGFWASC---------LHTYCFLTIYFLSVVVLLL--------TESVLC 111
            |:|:.|.|  .|: .|:..:..|         |.||..|.:..|.::|..:        .:..|.
  Fly    42 AIGILILG--GTI-LVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVFKKYALQ 103

  Fly   112 LAITLWPHCLGISLDETQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDY-DTSLWRL 175
            .....|      .|::|:           ||      ::|:.|..:.|||..|:.|| |...|  
  Fly   104 TVENQW------ELEQTK-----------PG------SMDIIQKTYYCCGRDSAQDYLDIKFW-- 143

  Fly   176 QGYGQRNWPVPLSCCFLKNAGHSMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYREQ 240
                  |..||.|||                 .:..|.:...|      :...||..::..:.::
  Fly   144 ------NNTVPSSCC-----------------KDDSCVNPLNL------YVRGCLIKVEEAFADE 179

  Fly   241 YSI-------FLGASLILAMIEFCVLLAIIMS 265
            .:.       .||.:.::      :|||||::
  Fly   180 ATTLGYLEWGLLGFNAVI------LLLAIILA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 58/284 (20%)
tetraspanin_LEL 117..241 CDD:239401 25/124 (20%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 53/269 (20%)
tetraspanin_LEL 94..178 CDD:239401 26/137 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.