DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:282 Identity:65/282 - (23%)
Similarity:95/282 - (33%) Gaps:108/282 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC------CFNYKFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLP-QP 58
            |.|      ||     ||..|.|..:.||                   .|:|.::..||..| ..
  Fly     1 MGCTSGCVKCF-----LNTLNTLNALSGL-------------------SLIAIATLALSKAPIAY 41

  Fly    59 LLFYIALGVAIAGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGI 123
            :||...||..|  ||   :||:|....|:...|....|..    |||.:.::.|        |||
  Fly    42 ILFLYGLGGII--FV---SAVLGCCGICMENVCMTATYGF----LLLAQLIISL--------LGI 89

  Fly   124 -------------SLDETQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRL 175
                         :.:|.||  ........||      |:|:.|..:.|||..|..|| .::.|.
  Fly    90 FRFKFTEEYIEKFAAEEVQM--KWDEELVEPG------AMDIYQTVYECCGRDSPDDY-VAIGRQ 145

  Fly   176 ----QGYGQRNWPVP--LSCCFLKNAGHSMAYLDPKPANESMCQSLERLSYERERHTESCLPHLD 234
                ..|.|.:..:|  |:.|..|::.:.:..                .||          .|..
  Fly   146 TLPPSCYPQEDPQMPHYLAGCVQKSSENFVVL----------------FSY----------AHDT 184

  Fly   235 NWYREQYSIFLGASLILAMIEF 256
            ||      |.||.::::.:..|
  Fly   185 NW------IALGITILMMIAAF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 61/269 (23%)
tetraspanin_LEL 117..241 CDD:239401 29/142 (20%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 63/276 (23%)
tetraspanin_LEL 94..174 CDD:239401 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.