DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42Eg

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster


Alignment Length:292 Identity:59/292 - (20%)
Similarity:97/292 - (33%) Gaps:116/292 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACCFNY--KFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYI 63
            |||..|.  .|.| ..:.:..:.||:::..|::|....:.                      |..
  Fly     1 MACSTNVLKGFAL-FWDIILALFGLVVIGLGVHIIYKFEH----------------------FNT 42

  Fly    64 ALGVAIA-GFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLW--PHCLGISL 125
            |..|.|| |.|..|.|:.|...:...:.....::.:.::||::.| ||.:.. ||  ...|.|::
  Fly    43 AAFVIIAVGVVVVLTALFGALGAARESSATSKVFVVILIVLVILE-VLAVGF-LWVFQTSLLINV 105

  Fly   126 DETQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCC 190
            |:|                                       :| .||..|       |||:   
  Fly   106 DKT---------------------------------------FD-KLWNDQ-------PVPI--- 120

  Fly   191 FLKNAGHSMAYLDPKPANESMCQSLER------------------LSYERER---HTESCLPHLD 234
                          ||.|:|...||||                  ..|..|.   :.|.|.....
  Fly   121 --------------KPGNQSQIASLERWLDCCGNVGPSDYILPPNSCYNGESDKLNLEGCRQKFL 171

  Fly   235 NWYREQYSIFLGASLILAMIE-FCVLLAIIMS 265
            ::..::::.|...||:|..:| .|.|||.:::
  Fly   172 DFIADRWTTFNLVSLVLLGVELICALLAYVLA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 55/283 (19%)
tetraspanin_LEL 117..241 CDD:239401 24/146 (16%)
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 53/272 (19%)
tetraspanin_LEL 95..176 CDD:239401 24/144 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.