DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42Ee

DIOPT Version :10

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_523631.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster


Alignment Length:202 Identity:46/202 - (22%)
Similarity:77/202 - (38%) Gaps:64/202 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIALGVAIAGF 72
            |::|.:.|.:..:.|:|.:|.|:.|.   |.|.:..:.......:.:| .|::. |:|| :|..|
  Fly     9 KYILFIFNTIVSVIGILGIVYGVLIL---KSIGVVEVNGQVGFPIQAL-MPIIL-ISLG-SIVVF 67

  Fly    73 VATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVRSLQSN 137
            ::.|    |...:...:.|....|...:::||:.:  |...:.|:.|                  
  Fly    68 ISFL----GCCGAIRESVCMTMSYATFLLILLILQ--LTFVVLLFTH------------------ 108

  Fly   138 YGVPGQEQFTNAL-------------------DLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNW 183
                 :|:|.||:                   |..|....|||..|:|||       .|.|..  
  Fly   109 -----REEFENAMGNVIENAWNSEHTYKGGVFDTIQKSLHCCGSSSALDY-------IGKGDL-- 159

  Fly   184 PVPLSCC 190
             ||.|||
  Fly   160 -VPPSCC 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspanin 8..>161 CDD:459767 33/171 (19%)
tetraspanin_LEL 117..241 CDD:239401 21/93 (23%)
Tsp42EeNP_523631.1 Tetraspanin 8..217 CDD:459767 46/202 (23%)

Return to query results.
Submit another query.