DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:274 Identity:67/274 - (24%)
Similarity:109/274 - (39%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRL-LAASSDRLSSLPQPLLFYIALGVAIAGF 72
            |:|.:.|.:|||.|:||:|.|..:.||     |||. :|.|....:::|        :.|.:.|.
  Fly    10 FILYIVNIVFLIVGILLIVLGSIMLSD-----LSRFDVAGSGTDPNTIP--------ICVTVLGG 61

  Fly    73 VATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHC-----LGISLDETQMVR 132
            :..:.:..|.:.....:.|....|...|.||.    :|.|.:|.|...     ||   |.:.:|.
  Fly    62 LIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLF----ILQLVLTCWVFVNRSAFLG---DMSNLVN 119

  Fly   133 SLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFLKNAGH 197
            .|..::      .:| |:.:.:..|||||       |||   ...|......||.:||       
  Fly   120 LLWDSH------DYT-AMGVLEETFGCCG-------DTS---YTNYNNIGLSVPGTCC------- 160

  Fly   198 SMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYREQYSIFLGASLILAMIEFCVLL-- 260
              .|||    .::.|.:   .|..:.|  ..|....:.::.:...|...:.|.|.:.:..|.|  
  Fly   161 --GYLD----RQATCNT---PSVYQSR--PGCSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIA 214

  Fly   261 AIIMSCTGLASQRA 274
            ..:.:|  :.||.|
  Fly   215 GALTNC--MRSQNA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 63/265 (24%)
tetraspanin_LEL 117..241 CDD:239401 28/128 (22%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 64/267 (24%)
tetraspanin_LEL 104..193 CDD:239401 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.