DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and Tsp39D

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:276 Identity:62/276 - (22%)
Similarity:103/276 - (37%) Gaps:80/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KFVLNLCNFLFLICGLLL-VVSGL----YIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIALGV 67
            |::...||.||.:.|||: :|.|:    |....|          ..||.:.:.|   :..:.:|.
  Fly    10 KYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSN----------FVSDHVWTAP---IILMIVGA 61

  Fly    68 AIAGFVATLAAVVGFWASC---LHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQ 129
            |:        ||:.|...|   ..:.|.:..:.|..||:.|.|..|.||        |. :..|.
  Fly    62 AV--------AVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLA--------GY-VKHTG 109

  Fly   130 MVRSLQSNYGVPGQE-----QFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSC 189
            :.:.::|.:....|.     .:.:|..|.|....|||:....|::|.        .||..:|.:|
  Fly   110 LHQIMESQFNSTMQHYKERADYRDAWTLLQTELDCCGINGPNDWETV--------YRNSTLPAAC 166

  Fly   190 CFLKNAGHSMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYREQYSIFLGASLILAMI 254
            |.:.|                :.::.|..:....:|  .||..|       ..|....:||||.:
  Fly   167 CSVIN----------------LSEAKECTNTHATQH--GCLQKL-------LEILDSKTLILASV 206

  Fly   255 EFCV----LLAIIMSC 266
            ...|    :|.|:.:|
  Fly   207 VLGVAGIQMLTILFAC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 62/276 (22%)
tetraspanin_LEL 117..241 CDD:239401 23/128 (18%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 62/276 (22%)
tetraspanin_LEL 104..200 CDD:239401 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.