DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and TSPAN12

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_036470.1 Gene:TSPAN12 / 23554 HGNCID:21641 Length:305 Species:Homo sapiens


Alignment Length:312 Identity:74/312 - (23%)
Similarity:134/312 - (42%) Gaps:55/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLP--QPLLFYIALGVAIAG 71
            :.|||..:|..| .:|.|.:.:..:.:|...|.:......:..|:..|  .|::..:...:.|.|
Human    15 YALNLLFWLMSI-SVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYFPVVHPVMIAVCCFLIIVG 78

  Fly    72 FVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPH----CLGISLDETQMVR 132
                   ::|:..:.......|..||.|::|:...|    ||..:|.:    .:.:...:...::
Human    79 -------MLGYCGTVKRNLLLLAWYFGSLLVIFCVE----LACGVWTYEQELMVPVQWSDMVTLK 132

  Fly   133 SLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFLKNAGH 197
            :..:|||:|.....|:|.:..|..|.|||:....|:      |: ..:.:|| |.|||..:..|.
Human   133 ARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDW------LE-MTEMDWP-PDSCCVREFPGC 189

  Fly   198 SMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYR--EQYSI--FLGASLILAMIEFCV 258
            |      |.|::      |.||   :.:.|.|...:.::.|  :|..:  |||.|:.:..|    
Human   190 S------KQAHQ------EDLS---DLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQI---- 235

  Fly   259 LLAIIMSCTGL-ASQRARLKKPVQEMRTQKVKSRQTLIENIYEPDVELRENS 309
             ||:|::.|.| |....|.:....:|.:.|..:.|    ::..|.|||.:.|
Human   236 -LAMILTITLLWALYYDRREPGTDQMMSLKNDNSQ----HLSCPSVELLKPS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 62/267 (23%)
tetraspanin_LEL 117..241 CDD:239401 30/129 (23%)
TSPAN12NP_036470.1 Tetraspannin 10..244 CDD:395265 62/268 (23%)
TM4SF12_like_LEL 116..218 CDD:239410 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.