DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and tsp-16

DIOPT Version :9

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_509183.2 Gene:tsp-16 / 192066 WormBaseID:WBGene00006642 Length:311 Species:Caenorhabditis elegans


Alignment Length:265 Identity:65/265 - (24%)
Similarity:98/265 - (36%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YIALGVAIAGFVATLAAVVGFWASCLH------TYCFLTIYFLSVVVLLLTESVLCLAITLWPHC 120
            |:.:.|.|..||.|   .|.|::..|:      |:.|.||:|.::..:     ...|...|..|.
 Worm    64 YLLILVGILSFVMT---PVRFFSIILNDNKIMITHMFATIFFATICAM-----TAILGYDLNSHV 120

  Fly   121 LGISLDETQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWP- 184
            ....: |..|..|::.:||.|.........:.|..:|.|||:|:..|:..|.|.:.   |:..| 
 Worm   121 SSSDM-EHWMKHSIKEDYGNPTAPHIMEEWNKAHRQFKCCGVRNLTDFVESKWYIM---QKKHPR 181

  Fly   185 --VPLSCC-------------FLKNAGHSMAYL-----------------DPKPANESMCQ---S 214
              :|.|||             |.|..|:....|                 |...||..:||   |
 Worm   182 QRIPDSCCASCATMHERFCVAFFKEPGNQPHQLVKNQTICLQASNGCLSADSSIANREVCQHYSS 246

  Fly   215 LERLSYERERHTESCLPHLDNWYREQYSIFLGASLILAMIEFCVLLAIIMSCTGLASQRARLKKP 279
            ..|||.:..|:|..||..|.....     |....:.:..:.|...||:......|..|.:|...|
 Worm   247 DYRLSADAYRYTGGCLEPLRTTLE-----FFSFRIFIYSLSFLAFLALSTLIWLLNYQISREALP 306

  Fly   280 VQEMR 284
            .|.::
 Worm   307 FQVIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 60/246 (24%)
tetraspanin_LEL 117..241 CDD:239401 40/159 (25%)
tsp-16NP_509183.2 Tetraspannin 26..>189 CDD:278750 36/136 (26%)
uroplakin_I_like_LEL 118..210 CDD:239409 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.