Sequence 1: | NP_729926.1 | Gene: | Tsp68C / 117407 | FlyBaseID: | FBgn0043550 | Length: | 362 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509183.2 | Gene: | tsp-16 / 192066 | WormBaseID: | WBGene00006642 | Length: | 311 | Species: | Caenorhabditis elegans |
Alignment Length: | 265 | Identity: | 65/265 - (24%) |
---|---|---|---|
Similarity: | 98/265 - (36%) | Gaps: | 59/265 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 YIALGVAIAGFVATLAAVVGFWASCLH------TYCFLTIYFLSVVVLLLTESVLCLAITLWPHC 120
Fly 121 LGISLDETQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWP- 184
Fly 185 --VPLSCC-------------FLKNAGHSMAYL-----------------DPKPANESMCQ---S 214
Fly 215 LERLSYERERHTESCLPHLDNWYREQYSIFLGASLILAMIEFCVLLAIIMSCTGLASQRARLKKP 279
Fly 280 VQEMR 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp68C | NP_729926.1 | Tetraspannin | 8..267 | CDD:278750 | 60/246 (24%) |
tetraspanin_LEL | 117..241 | CDD:239401 | 40/159 (25%) | ||
tsp-16 | NP_509183.2 | Tetraspannin | 26..>189 | CDD:278750 | 36/136 (26%) |
uroplakin_I_like_LEL | 118..210 | CDD:239409 | 25/95 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |