DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp68C and tsp-15

DIOPT Version :10

Sequence 1:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_492404.1 Gene:tsp-15 / 192065 WormBaseID:WBGene00006641 Length:258 Species:Caenorhabditis elegans


Alignment Length:59 Identity:14/59 - (23%)
Similarity:25/59 - (42%) Gaps:15/59 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LGKEDIEIHEEGDDSFSTEKPQNHREVSA--EKESENAGAEE-----------SCYEEE 95
            :..||.|  |...:::...||:..|.:|.  ...::.||.||           :||.::
 Worm   468 ISMEDCE--ENQTNAWFKSKPKMLRALSVIFRLTNDIAGFEEEMRRGEVVNGVNCYVKQ 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp68CNP_729926.1 Tetraspanin 8..>161 CDD:459767 14/59 (24%)
tetraspanin_LEL 117..241 CDD:239401
tsp-15NP_492404.1 Tetraspanin 16..>159 CDD:459767
uroplakin_I_like_LEL 110..228 CDD:239409
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.