DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub65B and yipf2

DIOPT Version :10

Sequence 1:NP_729172.1 Gene:betaTub65B / 117406 FlyBaseID:FBgn0052396 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001008078.1 Gene:yipf2 / 493440 XenbaseID:XB-GENE-997076 Length:301 Species:Xenopus tropicalis


Alignment Length:33 Identity:11/33 - (33%)
Similarity:16/33 - (48%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 SMSMLRRKAHLHWYTGEGMEEQEFQDAQQELQA 416
            |::...|..|...:.|...||:|.:..|.||.|
 Frog    29 SLTEESRPQHATLHVGGDSEEEEGESDQTELLA 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub65BNP_729172.1 beta_tubulin 2..425 CDD:276956 11/33 (33%)
yipf2NP_001008078.1 Yip1 94..267 CDD:461468
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.