DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Desat1 and scd

DIOPT Version :9

Sequence 1:NP_652731.1 Gene:Desat1 / 117369 FlyBaseID:FBgn0086687 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001027500.1 Gene:scd / 613092 XenbaseID:XB-GENE-988226 Length:338 Species:Xenopus tropicalis


Alignment Length:351 Identity:185/351 - (52%)
Similarity:239/351 - (68%) Gaps:21/351 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GAQSISDSLIAAASAAADAGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVMKKAE-KRRLKLV 71
            |:|::|..:           :||:.:|::     ...|...||.  :.|.|.:||.: |..:|||
 Frog     5 GSQTVSTVM-----------ESPSIIQDE-----IGADRVMTDD--IFDTTYIKKVDFKPPIKLV 51

  Fly    72 WRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAKWPLRV 136
            |||:|....||..|.||.: |:.:||..|...|...:::|.||:||||||||:|||||||.|||:
 Frog    52 WRNVILMALLHFGAFYGLF-MIPAAKPITLAWAILCFMLSALGVTAGAHRLWSHRSYKAKLPLRI 115

  Fly   137 ILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVD 201
            .|.:.|::|||:..|.|||||||||||||||||||||.|||||||:||||.:|||:|..|||.:|
 Frog   116 FLAVVNSMAFQNDIYEWARDHRVHHKYSETDADPHNAVRGFFFSHIGWLLMRKHPDVIEKGKKLD 180

  Fly   202 LSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNS 266
            ||||:||.::|||::.|.:.:.:.|||:|||:|.|.|.|||..|::|..:.|:..:||.||||||
 Frog   181 LSDLKADKVVMFQRRNYKLSILVMCFILPTVIPWYFWDESFSVAFYVPCLLRYALVLNATWLVNS 245

  Fly   267 AAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKI 331
            |||.:|.||||:.|||.||..|||.|.|||:|||||.||:||.|:||| ...|.||.|||....:
 Frog   246 AAHMYGNRPYDQTINPRENPLVAIGAIGEGFHNYHHTFPFDYSTSEFG-LKFNITTGFIDLMCLL 309

  Fly   332 GWAYDLKTVSTDIIKKRVKRTGDGTH 357
            |.|.|.|.||.:.|..|.||||||:|
 Frog   310 GLANDCKRVSKETIMARKKRTGDGSH 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Desat1NP_652731.1 Delta9-FADS-like 97..338 CDD:239582 145/240 (60%)
FA_desaturase 98..305 CDD:278890 127/206 (62%)
scdNP_001027500.1 Delta9-FADS-like 76..316 CDD:239582 145/240 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 292 1.000 Domainoid score I1499
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 373 1.000 Inparanoid score I2063
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - otm47596
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.