DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Desat1 and CG15531

DIOPT Version :9

Sequence 1:NP_652731.1 Gene:Desat1 / 117369 FlyBaseID:FBgn0086687 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster


Alignment Length:307 Identity:97/307 - (31%)
Similarity:168/307 - (54%) Gaps:17/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VETTDGGLVKDITVMKKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVI 110
            :|||.   ||:......:..::...:|..::.:.:|::..:||.|:::|||.|.|.:....|.::
  Fly     1 METTK---VKEPDQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLL 62

  Fly   111 SGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATR 175
            ..||:|.|.|||||||::.|..||:|.|:...|.|.|.:.|...:.||:||...:.|.||:.:..
  Fly    63 GTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKH 127

  Fly   176 GFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE 240
            .|.::.|...|.|..|:.:...|.||:|||.:||::||||::|::|......::....|...:|:
  Fly   128 SFMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGD 192

  Fly   241 SFMNAWFVATMFRWCFILNVTWLVNS-----AAHKFGGRPYDKFINPSENISVAILAFGEGWHNY 300
            |...:.||....|...::|:..||:|     :.|| |.:|.|     |.:|.:...::   |..|
  Fly   193 SLATSMFVGFWLRSLIVINLGNLVHSSHFIWSIHK-GFKPTD-----SNSIFLITKSY---WPQY 248

  Fly   301 HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKK 347
            |::.|.||::.|:|.|:....::.|..||.:.||.||||:.:..:::
  Fly   249 HYLLPRDYQSGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Desat1NP_652731.1 Delta9-FADS-like 97..338 CDD:239582 81/245 (33%)
FA_desaturase 98..305 CDD:278890 69/211 (33%)
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
98.920

Return to query results.
Submit another query.