DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Desat1 and Scd4

DIOPT Version :9

Sequence 1:NP_652731.1 Gene:Desat1 / 117369 FlyBaseID:FBgn0086687 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_899039.2 Gene:Scd4 / 329065 MGIID:2670997 Length:353 Species:Mus musculus


Alignment Length:291 Identity:163/291 - (56%)
Similarity:216/291 - (74%) Gaps:2/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAK 131
            :|:.||||||....||:.||||..| |.|.|..|.:|..|..|::||||||||||||:||:|||:
Mouse    62 KLEYVWRNIIFMALLHVGALYGITL-VPSCKVYTWLLGVFYNVVAGLGITAGAHRLWSHRTYKAR 125

  Fly   132 WPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAK 196
            .|||:.|::.||:|||:..|.||||||.|||:|||.|||||:.||||||||||||.:|||.||.|
Mouse   126 LPLRIFLIMANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEK 190

  Fly   197 GKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVT 261
            ||.:|:|||:|:.::|||::||.:.:.:...|:||:||.|.|||:|.::..|:...|:..:||.|
Mouse   191 GKNLDMSDLKAEKLVMFQRRYYKLAVTLMFIILPTLVPWYLWGETFQHSLCVSNFLRYAVLLNFT 255

  Fly   262 WLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFID 326
            ||||||||.:|.||||:.|...||..|::.:.|||:|||||.||:||..:|: ::.:||||.|||
Mouse   256 WLVNSAAHLYGYRPYDRGIGARENPFVSMASLGEGFHNYHHTFPYDYSVSEY-RWHINFTTFFID 319

  Fly   327 FFAKIGWAYDLKTVSTDIIKKRVKRTGDGTH 357
            ..|.:|.|||.|.||..::..|:||||||:|
Mouse   320 CMAALGLAYDRKKVSKAVVLARIKRTGDGSH 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Desat1NP_652731.1 Delta9-FADS-like 97..338 CDD:239582 136/240 (57%)
FA_desaturase 98..305 CDD:278890 118/206 (57%)
Scd4NP_899039.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Delta9-FADS-like 94..331 CDD:239582 135/237 (57%)
FA_desaturase 94..300 CDD:278890 119/205 (58%)
Histidine box-1. /evidence=ECO:0000305 114..119 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 151..155 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 292..296 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 291 1.000 Domainoid score I1524
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 369 1.000 Inparanoid score I2119
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm8712
orthoMCL 1 0.900 - - OOG6_100468
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.