DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Desat1 and Scd3

DIOPT Version :9

Sequence 1:NP_652731.1 Gene:Desat1 / 117369 FlyBaseID:FBgn0086687 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_077770.1 Gene:Scd3 / 30049 MGIID:1353437 Length:359 Species:Mus musculus


Alignment Length:291 Identity:168/291 - (57%)
Similarity:220/291 - (75%) Gaps:2/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAK 131
            :|:.||||||....||:.||||..| |.|.|..||:.|:..||||..||.||.||||:||:|||:
Mouse    68 KLEYVWRNIILMALLHVGALYGITL-VPSCKLYTCLFAFVYYVISIEGIGAGVHRLWSHRTYKAR 131

  Fly   132 WPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAK 196
            .|||:.|:|.||:|||:..|.||||||.|||:|||.|||||:.||||||||||||.:|||.||.|
Mouse   132 LPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEK 196

  Fly   197 GKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVT 261
            |..:|:|||:|:.::|||::||...:.:.|||:||:||.|.|||:|:|:::|||:.|:..:||.|
Mouse   197 GGKLDMSDLKAEKLVMFQRRYYKPGILLMCFILPTLVPWYCWGETFLNSFYVATLLRYAVVLNAT 261

  Fly   262 WLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFID 326
            ||||||||.:|.|||||.|:|.:|..|::.:.|||:|||||.||:||..:|: ::.:||||.|||
Mouse   262 WLVNSAAHLYGYRPYDKNIDPRQNALVSLGSMGEGFHNYHHAFPYDYSASEY-RWHINFTTFFID 325

  Fly   327 FFAKIGWAYDLKTVSTDIIKKRVKRTGDGTH 357
            ..|.:|.|||.|.||...:..|:||||||:|
Mouse   326 CMAALGLAYDRKRVSKATVLARIKRTGDGSH 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Desat1NP_652731.1 Delta9-FADS-like 97..338 CDD:239582 141/240 (59%)
FA_desaturase 98..305 CDD:278890 123/206 (60%)
Scd3NP_077770.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Delta9-FADS-like 97..337 CDD:239582 141/240 (59%)
FA_desaturase 102..306 CDD:278890 122/203 (60%)
Histidine box-1. /evidence=ECO:0000305 120..125 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 157..161 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 298..302 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845364
Domainoid 1 1.000 291 1.000 Domainoid score I1524
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 369 1.000 Inparanoid score I2119
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm8712
orthoMCL 1 0.900 - - OOG6_100468
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.