DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Desat1 and Scd

DIOPT Version :9

Sequence 1:NP_652731.1 Gene:Desat1 / 117369 FlyBaseID:FBgn0086687 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_631931.2 Gene:Scd / 246074 RGDID:621176 Length:358 Species:Rattus norvegicus


Alignment Length:291 Identity:169/291 - (58%)
Similarity:219/291 - (75%) Gaps:2/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAK 131
            :|:.||||||....||:.||||..| :.|:|..|.:...|.|:||.|||||||||||:||:|||:
  Rat    67 KLEYVWRNIILMALLHVGALYGITL-IPSSKVYTLLWGIFYYLISALGITAGAHRLWSHRTYKAR 130

  Fly   132 WPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAK 196
            .|||:.|:|.||:|||:..|.||||||.|||:|||.|||||:.||||||||||||.:|||.||.|
  Rat   131 LPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEK 195

  Fly   197 GKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVT 261
            |..:|:|||:|:.::|||::||...:.:.|||:||:||.|.|||:|:::.||:|..|:..:||.|
  Rat   196 GGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFLHSLFVSTFLRYTLVLNAT 260

  Fly   262 WLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFID 326
            ||||||||.:|.|||||.|...|||.|::.|.|||:|||||.||:||..:|: ::.:||||.|||
  Rat   261 WLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHAFPYDYSASEY-RWHINFTTFFID 324

  Fly   327 FFAKIGWAYDLKTVSTDIIKKRVKRTGDGTH 357
            ..|.:|.|||.|.||...:..|:||||||:|
  Rat   325 CMAALGLAYDRKKVSKAAVLARIKRTGDGSH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Desat1NP_652731.1 Delta9-FADS-like 97..338 CDD:239582 143/240 (60%)
FA_desaturase 98..305 CDD:278890 125/206 (61%)
ScdNP_631931.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 8..33
Delta9-FADS-like 99..336 CDD:239582 142/237 (60%)
FA_desaturase 100..305 CDD:278890 125/204 (61%)
Histidine box-1. /evidence=ECO:0000305 119..124 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 156..160 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 297..301 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348768
Domainoid 1 1.000 292 1.000 Domainoid score I1461
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 366 1.000 Inparanoid score I2092
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm8949
orthoMCL 1 0.900 - - OOG6_100468
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.