DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prt and SLC18A3

DIOPT Version :9

Sequence 1:NP_001097887.1 Gene:prt / 117368 FlyBaseID:FBgn0043005 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_003046.2 Gene:SLC18A3 / 6572 HGNCID:10936 Length:532 Species:Homo sapiens


Alignment Length:595 Identity:162/595 - (27%)
Similarity:259/595 - (43%) Gaps:135/595 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QAAVQLNAPGRRSSTPSGA---NGSSNRCLIAVIVYLALLLDNMLLTVIVPILPDYLASLEADTS 82
            :.|.|..|...:.|...||   .....|.|:.|||.:||||||||..|||||:|||:|.:.    
Human     5 EPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMR---- 65

  Fly    83 SAVVLSLEDTSSFSKLGYRSGESPGGGH-----PQLYISKHPIPGKSMVNFTLLQLSTEATTTTT 142
                                    |||.     |:::....|:|..:         :..|.|..|
Human    66 ------------------------GGGEGPTRTPEVWEPTLPLPTPA---------NASAYTANT 97

  Fly   143 SIATTTNSPHNSTSMQSPPKLTVGQSGGTNVTGIGHKSRNRKLASGHPPTHDNSSNDNSNKELTL 207
            |.:.|...|..|...                                 |.:...|          
Human    98 SASPTAAWPAGSALR---------------------------------PRYPTES---------- 119

  Fly   208 TQENGSIGLLLAMKALVQLIFNPIVGNASSKFGYRLPIVVGTFFLLLSSLVFTVGESYWALLVAR 272
              |:..||:|.|.||::||:.||:.|....:..|.:|:::|...:..|:::|...|.|..|..||
Human   120 --EDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAAR 182

  Fly   273 AVQGVGSACINICGMSLVAQHYPEEARRSKVMGIILGSIALGVLLGYPFGGILYDLMGKSAPFII 337
            ::||:|||..:..|::::|..||||..||:.:|:.|..|:.|.|:..|||||||:..||..||::
Human   183 SLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLV 247

  Fly   338 LSTLMFLSLGLQLLTMDLTVQPEVVVEDR-------PKWRSLLECKMILAIVLAIWFSTSTMAML 395
            |:.   :||...||.:.:..........|       |..|.:|: ..|..:..|:......:|.|
Human   248 LAA---VSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLD-PYIAVVAGALTTCNIPLAFL 308

  Fly   396 EPCLPIWLIQYLKPNKWQLGTVFIPDSVGYFVGTNFFGSIAYKYGQVK--VSCISLLLVGVASIL 458
            ||.:..|:...:..::|::|..::|..|.:.:|......:|.:|..::  ...:.|.::|.:|.:
Human   309 EPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGASSCI 373

  Fly   459 IPSATTVAQLLLPHFALGLGIGVIDAALVPLLATFVDATLAQEDQGEGSSSMSSYGTVYAIQQTS 523
            :|:..:.|.|::....|..||.::|.||:|.||..||.           ..:|.||:||||...|
Human   374 VPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDV-----------RHVSVYGSVYAIADIS 427

  Fly   524 VSLAYCLAPLIGGELAQTFGFAWLMRIVGIFNMIYGPILVYLHQ--------------------- 567
            .|:||.|.|::.|.:..:.||..|...:|:.|::|.|:|:.|..                     
Human   428 YSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQG 492

  Fly   568 KYDPKALREQ 577
            .||...|||:
Human   493 LYDAVRLRER 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtNP_001097887.1 MFS 212..565 CDD:119392 112/361 (31%)
MFS_1 212..532 CDD:284993 102/328 (31%)
SLC18A3NP_003046.2 MFS 124..458 CDD:119392 108/348 (31%)
MFS_1 124..436 CDD:284993 102/326 (31%)
Mediates interaction with SEC14L1. /evidence=ECO:0000250|UniProtKB:O35304 471..532 5/32 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..523 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3764
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59108
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.