DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prt and slc18b1

DIOPT Version :9

Sequence 1:NP_001097887.1 Gene:prt / 117368 FlyBaseID:FBgn0043005 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_012818405.2 Gene:slc18b1 / 548692 XenbaseID:XB-GENE-953331 Length:480 Species:Xenopus tropicalis


Alignment Length:394 Identity:95/394 - (24%)
Similarity:175/394 - (44%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 IGLLLAMKALVQLIFNPIVGNASSKFGYRLPIVVGTFFLLLSSLVFTV------GESYWAL-LVA 271
            |||:....|......:.|:|....:.|.:...|.|.|...:::::|.:      |..:.|| .|.
 Frog    95 IGLIFGCFAFFNFSTSLILGKHLVQIGAKFMFVTGMFVSGIATILFGMLDKTPDGPIFIALCFVV 159

  Fly   272 RAVQGVGSACINICGMSLVAQHYPEEARRSKVMGIILGSIALGVLLGYPFGGILYDLMGKSAPFI 336
            |:|..:|.........|::|:.:|...  :..||.:.....||.:||.|.||:||:..|...|||
 Frog   160 RSVDAIGFGAAMTASFSILAKAFPNNI--ATAMGCLEIFTGLGFVLGPPIGGLLYESFGYEIPFI 222

  Fly   337 ILSTLMFLSLGLQLLTMDLTVQPEV-VVEDRPKWRSLLECKMILAIVLAIWFSTSTMAMLEPCLP 400
            :|..::.|     ::.:::.:.|.. .|..:..:.:||.|..::.:...:...::::.:|:|.|.
 Frog   223 VLGCVVLL-----MVPLNMFILPRYDAVPSKDSFWALLTCPKVMLMCFTMVSLSTSLGVLDPTLS 282

  Fly   401 IWLIQYLKPNKWQLGTVFIPDSVGYFVGTNFFGSIAYKYGQVKV---------SCISLLLVGVAS 456
            :::|.........:|.||:..::.|.:.:...|.|:.::..::.         |.....|:|.|.
 Frog   283 LFVIDKFHLKVGYVGLVFLGLALSYSLSSPLLGLISDRFPGLRKWILIIGNLGSAFCFFLLGPAP 347

  Fly   457 IL-IPSA--TTVAQLLLPHFALGL-GIGVIDAALVPLLATFVDATLAQEDQGEGSSSMSSYGTVY 517
            |. |.|.  ..|..|||..|.:|| ||.|....|          :.|.|...|  ..:|:.|.|.
 Frog   348 IFQIESKLWMFVLMLLLDGFCIGLVGIPVYPEML----------SCAYEHGFE--EGLSTLGLVS 400

  Fly   518 AIQQTSVSLAYCLAPLIGGELAQTFGFAWLMRIVGIFNMIYGPILVYLHQKYDPKALREQHNDML 582
            .:.....:|...|.|..||.|.:...|.|...|.|:|.::.| ||..::..::..|:|::.|.::
 Frog   401 GVFGAMWALGSFLGPTFGGYLNERLHFEWTAAIQGLFPLVAG-ILCAIYYLWEGMAVRKRSNLLM 464

  Fly   583 LQSS 586
            ..|:
 Frog   465 ANST 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prtNP_001097887.1 MFS 212..565 CDD:119392 91/371 (25%)
MFS_1 212..532 CDD:284993 79/338 (23%)
slc18b1XP_012818405.2 MFS_SLC18B1 60..449 CDD:340943 91/373 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1371520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.