DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-Q and PIGQ

DIOPT Version :9

Sequence 1:NP_001285323.1 Gene:PIG-Q / 117366 FlyBaseID:FBgn0086448 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_683721.1 Gene:PIGQ / 9091 HGNCID:14135 Length:760 Species:Homo sapiens


Alignment Length:410 Identity:106/410 - (25%)
Similarity:181/410 - (44%) Gaps:103/410 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 IKVILYDKQMVRNLFVSGESENRRSLEYNDNDSTDCDFLELSRLNQPTADNQNKANNNANKSIQY 171
            :.:|.||::.|.                            ||:|:.||.....:|  .|..:...
Human   126 VMLIFYDQRQVL----------------------------LSQLHLPTVLPDRQA--GATTASTG 160

  Fly   172 GLTLIADS----------------PIKIFEYMAENV---------------------FINSIMVH 199
            ||..:.|:                |:::..:.:|.|                     .:.|::..
Human   161 GLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQSEGVEASILAELARRASGPICLLLASLLSLVSA 225

  Fly   200 TTIYKHFKEWQ--------TACD--------------------------KRSRPANIVLDRILGI 230
            .:..:.||.|.        :.|:                          |.:..|:::||..||:
Human   226 VSACRVFKLWPLSFLGSKLSTCEQLRHRLEHLTLIFSTRKAENPAQLMRKANTVASVLLDVALGL 290

  Fly   231 ILMLILF--TLATQPGDFLIQISHYVIDELYGLLKVLEGSPIGLKLNIHLNNFFLDCFKYHIELW 293
            :|:..|.  :......|.|:.::.:|.:||..||:.|.|:|.|||:|..|:......|.|||.||
Human   291 MLLSWLHGRSRIGHLADALVPVADHVAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLW 355

  Fly   294 STFLDFIEPLVRQVFLAIGMIGCLGFTFQIALLVDLISVIGLHSHCFYIYTKVLYNVERRGLSVL 358
            .:::..:.|.|..:...:|:..|||.|..::||.|:|:::..|.:|||:|...||.::..|||.|
Human   356 ISYIHLMSPFVEHILWHVGLSACLGLTVALSLLSDIIALLTFHIYCFYVYGARLYCLKIHGLSSL 420

  Fly   359 WQVVRGNRYNILKGRTESHNYMNRQLYLATIFFSAILFLLPTTLVYYIVFAALKALTFATLSVFH 423
            |::.||.::|:|:.|.:|.:|...||::.|:.|:.:|||||||.:||:||..|:.|..|...:.|
Human   421 WRLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLFTILLFLLPTTALYYLVFTLLRLLVVAVQGLIH 485

  Fly   424 FLRRKLMYLPIEVCIKRLLR 443
            .|...:..||:.....||.|
Human   486 LLVDLINSLPLYSLGLRLCR 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-QNP_001285323.1 Gpi1 240..401 CDD:282831 60/160 (38%)
PIGQNP_683721.1 Gpi1 277..449 CDD:309941 60/171 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 696..748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152973
Domainoid 1 1.000 137 1.000 Domainoid score I4910
eggNOG 1 0.900 - - E1_KOG1183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247641at2759
OrthoFinder 1 1.000 - - FOG0005188
OrthoInspector 1 1.000 - - oto90562
orthoMCL 1 0.900 - - OOG6_103823
Panther 1 1.100 - - LDO PTHR21329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.710

Return to query results.
Submit another query.